SecReT6
Protein ID: 148547838
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2622
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2991568..2992107 [+]
Producthypothetical protein
NoteTssB
UniProt IDA5W3P6
KEGG IDppf:Pput_2622
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.00E-61, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|148547838|ref|YP_001267940.1| unnamed protein product [Pseudomonas putida F1]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVYIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2991568-2992107 Pseudomonas putida F1 chromosome, complete genome
ATGGCGAAGAAGGAAAGCACTCAGCACAAACTCGACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACG
ACGTGGACATCGGCGATGCCATCGAGAAAAAGGAGCTGCCCTTCGTCGTCGGCGTACTGGGTGACTTCTC
CGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAGGACCGCAAGTTCGTGTACATCGACCGCGACAACTTC
AACGGTGTGCTCAAGGGCATCAAGCCACGCCTGACCTACCGCGTCGACAACACCCTGGCCAAGAACGGTA
CCCAGTTGGGCGTGGAGCTGAACTTCAACAGCCTCGAAGATTTCGAGCCACAGAACGTGGTCAAGCAGGT
CGAGCCGCTGCGCAAGCTGCTGGAAGTGCGCAACAAGCTGGCCGACCTGCGCAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGCTGCTGATGGACGTGCTGCAGAACACCGAAAAGCTCAAGACCTTGGGCAAGGAAT
TCGGCCGTGAAGCCGAAGTGAAAGACCCGTCCAGCGACGATCGCGCCTGA