SecReT6
Protein ID: 148547839
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2623
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2992122..2993624 [+]
Producthypothetical protein
NoteTssC
UniProt IDA5W3P7
KEGG IDppf:Pput_2623
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-196, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|148547839|ref|YP_001267941.1| unnamed protein product [Pseudomonas putida F1]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2992122-2993624 Pseudomonas putida F1 chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCGCCACAGC
CCTCGCTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGCATCGCCGAAATCGACGCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAGTTCCAGCAGCTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTGGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTGCGCGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCGCTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCACCTTTCG
GCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGTCTGCCGTATGG
CCCGGATACCACCCCGGTGGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGGGTCACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGTGTGGAAGGTGGCGGCCTGGTCGAAGGCCTGCCGACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGATCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAATACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTTGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTCGACGACACCGCCAGCC
AGGAGGCCAAGGCCAAGTTCCCGCTGCGCGAAGCGCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGG
CGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAGCTGGATGAACTGACCGCCTCGCTGCGGCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA