SecReT6
Protein ID: 148547840
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2624
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2993651..2994133 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA5W3P8
KEGG IDppf:Pput_2624
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|148547840|ref|YP_001267942.1| unnamed protein product [Pseudomonas putida F1]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2993651-2994133 Pseudomonas putida F1 chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCCTACCAGTCGG
CCGAGCCCGCAGCGCAGCGCACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTCGAAGT
TCTGGTGAACACCCGCCAGTCCCTGGTCGCCGAAGAGCTCGACGGCTTCAGCCAGCTCGGTGGTTCCATC
CTTGAATACGGCATGCCGGACTTCATCAGCCGCAGCGTGCTCGACCCGCACGATCGTCGCCTGATCCAGC
AACAGCTGGAACGGGCGATCAGCACCGGAGACCGGCGCTTTCGCCGGGTCCGTGTTCAGCTGTTGGCCCA
GCAGAACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTATTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA