SecReT6
Protein ID: 148547841
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2625
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2994133..2995953 [+]
Producthypothetical protein
NoteTssF
UniProt IDA5W3P9
KEGG IDppf:Pput_2625
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-212, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|148547841|ref|YP_001267943.1| unnamed protein product [Pseudomonas putida F1]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVELSLGRHEKVTEAYRVARHTEMHANPVEGVVCKFRTCYPVELWPIAV
QQASFTEMERSAFNGHSADLVAHLRIRLAATGDALFGQMDMNRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFDDQGRRREVALPADALNTVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEHVEVNFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCQPFFEPRGEQDPHSSFWVARRRNQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLLLPFGGERGDFTIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHLSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVF
LFGKVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2994133-2995953 Pseudomonas putida F1 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTTCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAGATCGCTTCGCGGCTGCTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCCCACTACCTGCGCCCTACTCCGTCGATGTCGATTGTCG
AACTGAGCCTGGGCAGGCACGAAAAAGTCACCGAAGCCTACCGCGTGGCGCGCCATACCGAGATGCATGC
CAATCCCGTGGAGGGCGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCACAGAAATGGAACGTTCGGCCTTCAACGGGCACAGCGCCGACCTGGTCGCTCATC
TGCGCATTCGCTTGGCTGCCACGGGCGATGCCCTGTTCGGGCAGATGGACATGAACCGCCTGCGGTTCTT
CCTCGACGGCGAAGCAACCCTGATGCTGCAGCTGTACGAGCTGCTGTTCAACAACCTGGCCAAGGCCACG
CTGAGCTTCGACGACCAGGGCCGCCGCCGCGAAGTGGCGCTGCCGGCCGATGCCCTGAACACCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCATTCCTGGGCTACCGCCTGCTGCACGAGTA
TTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTCAGTGGATTTGCCCGTATCCTGCAGGGCAAGGCC
ATCGAACATGTAGAGGTCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACCC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACCCCTGACACACGGCTGCACAACGCTGCA
GAAGTGGTATCGATCGACCGGGTACGGCGGGTGCGCAAACTCGGCGGTATCGACCAGGTCGCCACCTGCC
AGCCGTTTTTCGAACCCCGGGGCGAGCAAGACCCACACAGCAGCTTCTGGGTCGCGCGCCGGCGAAACCA
GGGTGACGCCACTGCCATGAGCATCCGCGTGGTCGACCGCGATCTGGAATTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGACGTGCCGCTGCTGCTGCCGTTCGGTGGCGAACGGG
GCGATTTCACCATTCCCGCCAACTCGGTGATCAAGGACATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGCGTGCCCTTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACTTGTCGCTGAACCACCTGTCCCTG
GTCAGCCAGGGCCGCGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAACCGGTGGTCGCGCGCATCGGCCACCCGCGGCC
AAATTTCGTGCGCGGGGTCGGCATCACCCTGACCCTGGACGAAAGCCAGTTCATCGGCAGCGGCGTGTTT
CTGTTCGGCAAAGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTACAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A