SecReT6
Protein ID: 148547842
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2626
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2995917..2996987 [+]
Producthypothetical protein
NoteTssG
UniProt IDA5W3Q0
KEGG IDppf:Pput_2626
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|148547842|ref|YP_001267944.1| unnamed protein product [Pseudomonas putida F1]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVQPFAGRWLHLQPEQCTQLGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLNLADYQRFQP
GTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2995917-2996987 Pseudomonas putida F1 chromosome, complete genome
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGTACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGAC
CTGCACTTCGAGCGCGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCA
TGGGCCTGGTCGGGCCGTCGGGCGTGCTGCCACGCCCGTACACCGAGCTGCTGCTCGAGCGCCACGTGCA
GTATCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAG
GCCTGGCAAAAATACAAATTCCACATCGAGCACGAGCGCAATGGCACTTCGGGCTTCGACGGCTACCTGC
TCAACCTGGTTGGCCTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCG
TGAGCTGTTCAGCTATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTTGAACGCATG
CTCGGTTTCTATTTCTCGCTGCCGATCAAGGTCCAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCG
AACAATGCACCCAGCTTGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTG
GGACTATCAGTCGTGCATCCGTATCGAGCTGGGCCCGCTGAACCTGGCCGACTACCAGCGCTTCCAGCCG
GGCACCGCCTGCTACCGCAAGCTGGTCGAGCTGGTGCGCTTCTATATAGGTGCCGAACTGGATTTCGAAA
TTGCCCCGCGCCTCAAGCGCGAGGCGGTGCCACGCGCCCAACTGGGCCGCAGCGGCAATGTCGCCCTGGG
CTGGCTGGGTTGGCTCAAACGCCCGGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTTTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA