SecReT6
Protein ID: 148547844
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2628
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2999606..3000328 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA5W3Q2
KEGG IDppf:Pput_2628
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-35, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|148547844|ref|YP_001267946.1| unnamed protein product [Pseudomonas putida F1]
MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDAPQKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQD
AAIDKATDAASQSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2999606-3000328 Pseudomonas putida F1 chromosome, complete genome
ATGCAACACAAGCACATCGTCCTCAAACGCCTGACCGCAGCCGCCTTGCTGGTAGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTATCAGCTGACCGACCTCGAGCGCTTCGCGGCTACCGATGCCGAGACCCTGTGGGACGCCC
CGCAAAAAGCCTTGGGCAACACCCTGGTGGAAACCCGCGAGATCACCCTGCTGCCCGGCATTGGCCAGAT
CGACCAGTGGCCGCTGGCCAAGAACGCGCGCTACGTCGGCGTGGCGGCGTTCTTCCGCGATGAGCAGGAC
GCGCGCTGGAAAGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCCTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTGGACGTACTGAACAAACCACCGAC
CGCCGACCAGCTTGCCGCTGCGCAGAAGGCCAAGGATGCCGACGCGACCCTCACCGACAAGGTGCAGGAC
GCGGCCATCGACAAAGCCACCGACGCCGCCAGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAATT
CTTTAGTGGATAGCGTCAAATGA