SecReT6
Protein ID: 148547845
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2629
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3000325..3001668 [+]
Producthypothetical protein
NoteTssK
UniProt IDA5W3Q3
KEGG IDppf:Pput_2629
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-136, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|148547845|ref|YP_001267947.1| unnamed protein product [Pseudomonas putida F1]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNVDPHFVHPTLHLGSHETIAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYER
MISAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3000325-3001668 Pseudomonas putida F1 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTATCAGG
ACGAATTCCATCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGCACCCCTTTCCATTGGGGGGTTCAGGC
GCTGCAGGTGGACGAGGACGCCCTGGCCAATGGTTCACTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCC
GATGGCAGCCTCTACGACGCGCCGCAGCACGATCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTGTATGCCGCGCTCAAGCTGCCCGAGCCATTCGGCCTCAACTACGTCGAGGA
TGGCCATGAACACAAGGCCGCACGGCGTTTCCGCAAGCAGTTCGACACCCTGCCCGACCTTAATGAAGGC
GAACTGGAAAACGAAATCACCAGCTTGCGCCTGAACGTCGTGCTGCTGGTCGACGGTGACAGCCTCGACG
GTTACAGCCACTGCCCACTGGCCAAGCTGACACGCAACAGCATGGGCGGTTTCAACGTTGACCCGCATTT
CGTCCACCCCACCTTGCACCTGGGCAGCCACGAGACCATTGCCGGCATCGGCAAGCGCCTGCTCGGTGCC
CTGCAGGCCAAGAGCAAGGCGCTTTCCGGCCGGCGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGATGTGACCCTGTTCTGGCTGCTGAACACGGTCAACCGTGCCCACCCGCAGCTGGCGCATCTACT
GGCCCACCCGCGCCTGCACCCGGAGCGCCTGTACCTGTTCCTGGCGGACCTTGCCGGCGGCCTGCTGACC
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACGACCACCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAAATGATCCGGGTGATGCTCGACAACGTTGTGCCCAACCAGTGCATTGTCATCAACCTGAC
CCAGACCAAGCCATCGCACTGGCAAGGCCAACTGCACGACCCGCGCCTGGCCGAAGCCGACTTCTATATC
GCCGTGCACGCCGACATGCCCGGCGCCAGCCTGCTGGAACTGGTGCCCCGTGCCTTCAAGGTCGGTTCGC
CGGAAGACATTGAAGTGGTGGTCAACAGCGCCATGCCGGGTGTCACCCTCAATCATGCCGCGCGGCTGCC
GAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCACACGGCACTGTGTATGAGCGA
ATGATCAGCGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA