SecReT6
Protein ID: 148547846
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2630
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3001665..3002381 [+]
Producthypothetical protein
NoteTssL
UniProt IDA5W3Q4
KEGG IDppf:Pput_2630
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-53, Aligned region: 21..221
Protein Sequence: 238 a.a.     [Download]
>gi|148547846|ref|YP_001267948.1| unnamed protein product [Pseudomonas putida F1]
MTEAVLQQGAVPAASDKPTFKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3001665-3002381 Pseudomonas putida F1 chromosome, complete genome
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCCCGGCCGCCAGCGACAAACCGACGTTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGTTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCAGGCCTTCGA
AGGTAGCGTCGAACGCTTCTTCGCCAACCTGGAACGTGATGCCCGTGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCGTTGTGCGCCTTCCTCGACGAAAGCGTACTGCGCTCGGACGACAACGCGT
TGCGTCGGCACTTTGAACTTCAGCCGTTGCAGTTCCGCTATTTCGGCGTGCACCTGGCCGGCGAAGGGTT
CTTCGAGAAGGTCGATGCGCTGCGCGCCGACGTCAAGCAGAACATCGACGTGCTCGAGGTCTACCACCTG
TGCCTGGCACTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAAAAGGACCAGCTGCGTTACCTGGCCAATA
CACTGGGCCAGGATATCGCCCGCTACCGCAAGGCGCCCAAAGCCCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTACCGCTGTGGGTGTATCTGGCGCTGATCGCGTTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTGTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA