SecReT6
Protein ID: 148547851
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2635
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3010370..3011455 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA5W3Q9
KEGG IDppf:Pput_2635
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.30E-22, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 5.30E-22, Aligned region: 241..257
Protein Sequence: 361 a.a.     [Download]
>gi|148547851|ref|YP_001267953.1| unnamed protein product [Pseudomonas putida F1]
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGL
AQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPIIQGQHFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSL
NACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAIPEEAQPQATGANLHEAGEAM
NATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNV
VDNIRDVLGTR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3010370-3011455 Pseudomonas putida F1 chromosome, complete genome
ATGCCTGAAATTCTCAATGACCTCTCGCTGGCCACACTGGTCGCCCCTATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCGGACCCAGACTACCTGACCCA
GGGCGACTGGCAAACCGACTTGAAGACTGCCGACTGGGAGCAGGTGATCAACCTGTCGGCTCAAGGGCTT
GCGCAGCAAAGCAAAGACCTGATGCTGGTGGCCTGGCTCTGCGAGGGGCTGGCCCAGCGTGAACACTTCG
AAGGCATCACCTTTGGCCTCGAGCTGACCGAACAGCTCCTGGTTGCGTTCTGGGAAACGCTGTACCCCAC
CCTCGAAGACGGCCTGGACGAGCGCGCGGCGCGACTGTCCTGGTTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTATCCAAGGGCAGCATTTTGGCGTGTTGCGCTATGACGAATCACGCCATGTAGAAA
ACCTCGCCTTGCAAAACCCCAAGGCGATGCAGACAGCGCTGAACGAAGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTAGCGCTTACCGACACCGATTACCTGCGCGCCAAGGCCCAGCAGATCGCTACCAGCCTG
AATGCATGCAAACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTTTCGCGTGCCAGCCAGCTGGCGGAAAAACTGCTCAAGGACCGCGGCGTCGAGCTACA
CCCCGCCATCCCGGAAGAAGCACAGCCACAGGCCACGGGTGCCAACCTCCACGAAGCAGGTGAAGCGATG
AATGCCACGCCCCCGACGACCGCACCTGCAGCCCTGCGCACCACCCCGCTGACCCGCGACGAGGCATTCA
CCATGCTTGCGGGCATCGCCCAGTACTTCAAACAGAGCGAACCGCAAAGCCCGGTACCCTACCTGATCGA
ACGTGCGATCAAGTGGGGCAACATGCCGTTGGAAGGCTGGTTGAGTGACGTGATCAAGGACAACAATGTG
GTGGACAACATCCGCGATGTGCTGGGCACCCGCTAG