SecReT6
Protein ID: 152969875
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01322
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1483578..1484069 [+]
Producthypothetical protein
NoteTssB
UniProt IDA6T833
KEGG IDkpn:KPN_01322
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.20E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|152969875|ref|YP_001334984.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1483578-1484069 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAAAAGAAGGTCGAACTGCCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGGAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAGCTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA