SecReT6
Protein ID: 152969876
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01323
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1484106..1485656 [+]
Producthypothetical protein
NoteTssC
UniProt IDA6T834
KEGG IDkpn:KPN_01323
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-171, Aligned region: 90..512
Protein Sequence: 516 a.a.     [Download]
>gi|152969876|ref|YP_001334985.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MLMSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASCLGDINDFLDDAALSEAPAAERLTAAMQV
FMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTE
ILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAA
HMPFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVK
IPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKL
YAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1484106-1485656 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGCTAATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGCGCGG
GCGAGGGCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCACCCCGGCGTCTTGCCTCGGGGATATCAA
CGACTTTCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAGCGTCTCACCGCGGCGATGCAGGTG
TTTATGGAACGCATCCGTCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGACCACCATA
TCGCCGAGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGT
CGAATCCCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAG
ATCCTCGACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCC
TGTACTGGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGC
CTATGAGTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCC
CATATGCCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCA
TTAAGGATATCGGCAACTACTTCGATCGTGCGGAATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGA
TGCCCGCTACATCGGCCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCG
GTGCGCAGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGATCACGAAAAATATCTCTGGACCAGCGCGG
CGTTCTCCTTCGCATCTAATATGGTGAAGAGCTTTGTTAACAACGGCTGGTGCGTGCAAATTCGCGGTCC
GCAGGCGGGCGGCGCGGTGAAAGATTTGCCTATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAG
ATCCCTTCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGT
CGTACTACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGA
TACCGCCGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTACATCTTCCTGCTGTCGCGCATC
GCGCACTACCTGAAGATGATCCAGCGCGAAAATATCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGG
AGCTGAACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCA
TCCGCTGCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTG
TACGCGGTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGG
CGAAGGCGTAG