SecReT6
Protein ID: 152969877
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01324
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1485666..1487009 [+]
Producthypothetical protein
NoteTssK
UniProt IDA6T835
KEGG IDkpn:KPN_01324
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-136, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|152969877|ref|YP_001334986.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDT
RQIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLARQLEQLLVQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1485666-1487009 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGTGCGCTTCCGGCAGCGCTGGCGCGATGTCCGTAACCAGTTTGGGGATGATACC
CGGCAGATTGCCGTCATACAGCCGGAGCTGATCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGAGGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTAGCCGATG
TCTCTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCG
GCAAAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTC
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGTTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGGGTGGTGGCGATTGCGCTGGAGCATGATGT
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTACGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCGACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTGGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA