SecReT6
Protein ID: 152969879
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01326
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1487692..1489398 [+]
Productputative outer membrane protein
NoteTagL
UniProt IDA6T837, A6T837
KEGG IDkpn:KPN_01326
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.00E-16, Aligned region: 148..159
OmpA [PF00691], Evalue: 5.00E-16, Aligned region: 438..534
Protein Sequence: 568 a.a.     [Download]
>gi|152969879|ref|YP_001334988.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSPAQQRGLALWASLLSALVCLLFLPVPRWGAWLILLVTLALIIGIWRIASRRTGRNVASTLAPLPEGAY
RQPVVLVCGDLPCVWPPASPVRVVKQGCWIRVEKTEELQQVARQVLSQRPEWGPQLSVLLCVCPQRHAQS
DALTSALLALRWQLSQLRQQTGYAVPLALQGQVGSAMSRDLLWQAAIPGEAVKVWQPSCAPCSVPAWVSA
GGAAALEQQVLMNSLMGWFEQHVHAVLTEENIDLPPLTPAAVLWGLGPSLPGSLASSAWTTWLSRHSGLS
RVAGWQPDESDTGDASALPEFILPQLPAGRGLTPRGRAWRAALAIFTLAAVAALLSSGWNNRQLLQRVGV
DIARYERIAMDDYRPKASAVRVLREDAALLDSWARNGVPLRLSLGLYRGEQIRLPLLEAIRGYVPPPPPP
RPVQRVAPNVIRLDSMSLFDTGKWVLKPGSTKRLVNSLMDIKARPGWLIVVAGHTDSVGEEKANQLLSLK
RAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQVDACRLPDQPSASSQDD
GASLHNGE
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1487692-1489398 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGAGCCCCGCGCAGCAGCGTGGGCTGGCGCTGTGGGCCAGTCTGCTGAGTGCGCTGGTGTGCCTGCTAT
TTTTGCCGGTTCCCCGCTGGGGGGCGTGGCTCATTCTGCTGGTCACGCTGGCCCTGATCATCGGGATCTG
GCGCATCGCCAGTCGTCGTACCGGACGTAACGTCGCATCAACCCTGGCCCCTCTCCCGGAGGGCGCTTAT
CGCCAGCCGGTGGTCCTCGTTTGCGGCGACCTGCCGTGTGTCTGGCCGCCAGCGTCACCGGTGCGAGTCG
TCAAACAGGGCTGCTGGATCCGCGTGGAAAAGACGGAGGAGCTGCAGCAGGTCGCGCGCCAGGTATTGAG
CCAGCGGCCGGAATGGGGGCCTCAGCTGTCGGTGCTGCTCTGCGTCTGCCCGCAGCGGCATGCGCAAAGC
GATGCGCTGACCAGCGCTCTGCTGGCCCTGCGCTGGCAACTCAGCCAGCTGCGCCAGCAGACGGGGTATG
CCGTACCGCTGGCGCTGCAGGGGCAGGTGGGCAGCGCGATGAGTCGCGACCTGTTGTGGCAGGCGGCGAT
ACCGGGTGAAGCGGTGAAAGTCTGGCAGCCCTCCTGCGCCCCCTGTTCCGTACCGGCCTGGGTAAGCGCC
GGCGGGGCGGCCGCGCTGGAGCAGCAGGTGCTGATGAACAGCCTGATGGGCTGGTTTGAACAGCACGTCC
ATGCCGTGTTGACGGAAGAGAATATCGACCTGCCGCCTCTGACCCCAGCGGCCGTGCTGTGGGGCCTCGG
GCCCTCGCTGCCTGGAAGTCTGGCGTCGTCGGCCTGGACGACGTGGTTATCCCGACATAGCGGCCTGTCG
CGGGTAGCTGGCTGGCAGCCAGATGAGAGCGACACCGGGGACGCTTCAGCTTTGCCGGAATTCATCCTGC
CGCAGTTACCGGCGGGACGGGGACTCACGCCACGAGGCAGGGCCTGGCGCGCGGCGCTCGCGATTTTCAC
CCTCGCGGCTGTCGCCGCGCTGCTCAGCAGTGGCTGGAACAATCGACAACTGCTGCAGCGCGTGGGCGTC
GATATTGCGCGTTATGAGCGGATTGCGATGGATGATTATCGACCAAAAGCCAGCGCTGTCAGGGTGCTGC
GTGAAGATGCCGCGCTGCTTGATAGCTGGGCGCGTAACGGCGTCCCGCTGCGCCTGAGTCTGGGCTTGTA
TCGCGGGGAGCAGATTCGCCTGCCGTTGCTGGAGGCGATTCGCGGTTACGTGCCGCCTCCGCCTCCGCCC
AGGCCGGTGCAGCGCGTTGCCCCGAACGTCATCCGCCTTGACAGCATGTCGCTATTCGATACCGGGAAAT
GGGTACTGAAGCCTGGTTCGACAAAGCGGCTGGTCAACTCGCTGATGGACATTAAGGCCAGGCCCGGGTG
GCTGATCGTGGTGGCGGGTCACACCGACAGCGTGGGTGAGGAAAAAGCCAACCAGCTATTGTCGCTGAAA
CGTGCGGAATCGGTCCGCGACTGGATGCGCGATACCGGCGACGTGCCGGACAGCTGCTTTGCCGTTCAGG
GCTATGGCGAAAGCCGACCAATTGCAACAAACGATACGCCGGAAGGCCGTGCGCTGAACCGTCGTGTCGA
AATCAGTCTGGTGCCGCAGGTAGACGCCTGCCGGTTACCGGACCAACCCTCTGCGTCATCCCAGGATGAT
GGCGCTTCACTACACAATGGAGAGTAA