SecReT6
Protein ID: 152969881
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01328
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1490213..1492813 [+]
Productputative protease
NoteTssH
UniProt IDA6T839
KEGG IDkpn:KPN_01328
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.80E-40, Aligned region: 218..237
AAA_2 [PF07724], Evalue: 9.80E-40, Aligned region: 592..757
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 220..332
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 597..718
AAA_5 [PF07728], Evalue: 8.20E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 8.20E-15, Aligned region: 318..350
AAA_5 [PF07728], Evalue: 8.20E-15, Aligned region: 596..716
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 121..140
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 197..242
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 265..298
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 433..493
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 565..633
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 660..691
AAA_16 [PF13191], Evalue: 5.90E-14, Aligned region: 736..781
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 365..388
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 765..837
AAA_22 [PF13401], Evalue: 2.30E-09, Aligned region: 46..131
AAA_22 [PF13401], Evalue: 2.30E-09, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 2.30E-09, Aligned region: 593..631
AAA_25 [PF13481], Evalue: 3.80E-09, Aligned region: 220..295
AAA_25 [PF13481], Evalue: 3.80E-09, Aligned region: 592..625
AAA_19 [PF13245], Evalue: 3.70E-08, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 3.70E-08, Aligned region: 592..618
Arch_ATPase [PF01637], Evalue: 7.20E-07, Aligned region: 198..235
Arch_ATPase [PF01637], Evalue: 7.20E-07, Aligned region: 272..369
Arch_ATPase [PF01637], Evalue: 7.20E-07, Aligned region: 589..610
Arch_ATPase [PF01637], Evalue: 7.20E-07, Aligned region: 666..678
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 214..280
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 596..616
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 214..244
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 582..636
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 220..259
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 596..621
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 220..284
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 595..631
Clp_N [PF02861], Evalue: 5.60E-05, Aligned region: 4..40
Clp_N [PF02861], Evalue: 5.60E-05, Aligned region: 87..103
Sigma54_activat [PF00158], Evalue: 9.30E-05, Aligned region: 204..234
Sigma54_activat [PF00158], Evalue: 9.30E-05, Aligned region: 596..713
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 220..317
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 594..678
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 220..242
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 597..626
AAA_33 [PF13671], Evalue: 0.00078, Aligned region: 220..237
AAA_33 [PF13671], Evalue: 0.00078, Aligned region: 376..419
AAA_33 [PF13671], Evalue: 0.00078, Aligned region: 595..617
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 221..242
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 597..618
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 833..865
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 592..620
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 220..237
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 423..512
AAA_23 [PF13476], Evalue: 0.0027, Aligned region: 593..619
ResIII [PF04851], Evalue: 0.0033, Aligned region: 205..242
ResIII [PF04851], Evalue: 0.0033, Aligned region: 290..302
ResIII [PF04851], Evalue: 0.0033, Aligned region: 570..624
AAA_28 [PF13521], Evalue: 0.0041, Aligned region: 220..244
AAA_28 [PF13521], Evalue: 0.0041, Aligned region: 596..616
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 205..237
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 507..548
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 595..608
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 773..818
AAA_30 [PF13604], Evalue: 0.0084, Aligned region: 217..240
AAA_30 [PF13604], Evalue: 0.0084, Aligned region: 593..619
T2SE [PF00437], Evalue: 0.0093, Aligned region: 200..239
T2SE [PF00437], Evalue: 0.0093, Aligned region: 461..487
T2SE [PF00437], Evalue: 0.0093, Aligned region: 593..674
Protein Sequence: 866 a.a.     [Download]
>gi|152969881|ref|YP_001334990.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLLSWLDKQPRSVRHRPQLSD
HTLRLMQEAWLIASLSGEAQIRSVHLLMALVEKQNLIQCDGLWPLLTLGQRQLERLRSLLDAQSDERPPA
QQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALDKFTLDVTAKARDGQIDPVFGRDTEIRQMVDI
LSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVSVRTLDLGLLQAGAGVKGEFEQRLKNII
EAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRF
QMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQLPDKAVDLLDTASARLRM
SLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLILALDTLETQYGQELQLTE
ALLACRRDISRQAEISDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVPLSSLMKDEQTELLSLEES
LGKRVVGQEAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTETALALADALFGGEKALITINLS
EYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGGMRDGEGR
EIDFRNTVILMTANLGSDLLMQLLDEQPEASESDLHELLRPVLRGHFQPALLARFQTVIYRPLPAAALRA
IVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGARNVDSLLNQQILPALSQQLLSHMAAGQK
PRQVTLGYHEEEGVVMAFDEGTISDE
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1490213-1492813 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGAGGGGGCGGCCTCCCTGTGCCAGACCCGGGCGCATGCCGAGATCCTGCCCGAGCACTGGCTGCTCA
AGCTGCTGGAACAGGGGGAAGGCGATCTGACGGTGCTGGCGCGGCGCTATGAATGGGATATGGATGCTCT
GTGGCAGGATCTGCTGAGCTGGCTGGATAAACAGCCGCGCTCGGTACGTCATCGTCCCCAGCTCTCTGAC
CATACCCTGAGGCTGATGCAGGAGGCCTGGCTGATTGCCTCTCTCAGCGGCGAAGCGCAGATCCGCAGTG
TTCACCTGCTGATGGCGCTGGTTGAAAAACAGAATCTGATCCAGTGCGATGGCCTGTGGCCGCTGTTAAC
GCTGGGCCAGCGTCAGCTGGAACGCCTGCGCTCCTTGCTGGATGCCCAGTCCGACGAACGTCCGCCAGCG
CAGCAGGAAGCGGCGCTGGCGCAGCCCCATGGCGGGGACGTGGAATTTGTGGGGCGTCCTGCGGGCAGCG
AACTGAATGCGGATGGGCTCAACCCGGCGCTGCAGAACGCGCTGGACAAATTCACTCTCGACGTCACCGC
CAAAGCCAGAGACGGCCAGATTGACCCGGTGTTCGGACGCGACACGGAAATCCGCCAGATGGTGGATATT
CTCTCCCGTCGGCGAAAAAACAACCCAATCCTCGTCGGTGAGCCGGGCGTGGGCAAGACCGCTCTGGTGG
AAGGCCTGGCGCTGCGCATTGCCGAAGGCAACGTCCCCGACGCGCTGAAGCCAGTGTCGGTGCGCACCCT
TGACCTCGGTCTGCTGCAGGCCGGCGCCGGGGTCAAAGGCGAGTTCGAGCAGCGGCTGAAAAATATCATT
GAGGCGGTACAGCAGTCGCCTTCGCCGGTGCTACTGTTTATCGACGAGGCGCACACGATCATCGGCGCGG
GTAATCAGGCGGGCGGCGCGGATGCCGCCAACCTGCTGAAGCCGGCGCTGGCCCGGGGCGAACTGCGGAC
TATCGCCGCCACCACCTGGAGTGAATACAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGCTTT
CAGATGGTCAAGGTGGATGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCT
ATGCCGACCACCACGGCGTGCATATCACGGATGATGCGGTGCGCGCCGCCGTGACGCTGTCACGACGCTA
TCTCACCGGTCGCCAGCTGCCGGACAAGGCAGTGGATTTACTCGACACCGCTTCCGCCCGCCTGCGTATG
AGTTTGGATACCGTGCCTGAGCCGCTGACCCGCATGAAGGCGCAGCTCACCGCGCTGGCAATGGAGAAGC
AGGCGCTGCTGGAAGATATTGCGCTGGGCAACAGCGCCCGCGGCGATCGGCTGGCGGCCATTGAGCAGGA
GGAGATCCGCCTTATTCTGGCGCTGGATACCCTTGAAACTCAGTATGGTCAGGAGCTGCAGCTGACGGAA
GCGCTGCTCGCCTGTCGCCGCGATATCTCCCGCCAGGCGGAAATTAGCGATCTACAAACCGCGCTTATCG
CCGTCCAGCAGGGCAATCCGCTGCTCGGGCTGGACGTCGACGTCCGCACCGTGGCGACGGTGATTGCCGA
CTGGACCGGCGTGCCGCTCTCCTCGCTAATGAAAGATGAGCAGACGGAGCTGCTGAGTCTGGAAGAGAGT
CTCGGCAAACGGGTGGTTGGCCAGGAGGCGGCCCTGAGCGCTATTGCCCGGCGCCTGCGCGCCGCGAAAA
CCGGCCTGACGCCGGAGAACGGTCCGCAAGGGGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAAC
GGAAACGGCGCTCGCCCTGGCCGATGCGCTGTTCGGCGGCGAGAAAGCGCTGATCACCATCAATCTCTCC
GAGTACCAGGAGCCGCACACCGTCAGCCAGCTGAAGGGTTCTCCGCCCGGCTACGTCGGCTACGGCCAGG
GCGGGATCCTGACCGAGGCGGTGCGCAAACGCCCCTACAGCGTGGTGCTGCTCGATGAGGTGGAAAAGGC
CCATCGCGATGTGATGAACCTGTTCTACCAGGTCTTCGACCGGGGGGGAATGCGCGACGGCGAGGGGCGT
GAAATCGACTTTCGCAACACCGTGATCCTGATGACCGCCAACCTCGGAAGCGACCTCCTGATGCAGTTGC
TGGATGAACAGCCGGAGGCCAGCGAATCAGACCTGCACGAGCTGCTGCGCCCGGTACTGCGCGGCCACTT
CCAGCCGGCGCTGCTGGCCCGCTTCCAGACGGTGATTTACCGTCCGCTGCCGGCGGCAGCGCTGCGCGCC
ATTGTCGGCATGAAGCTCGGGCAGGTAAGTCAGCGTCTGGCTTGCCATTACGGAATCACCACCACCCTCA
GCGAGAGCCTGTTCGACGCGCTGACCGAGGCCTGCCTGCTGCCGGATACCGGCGCCCGTAACGTCGACAG
TCTGCTCAATCAGCAGATCCTGCCGGCACTGAGTCAGCAGCTATTGAGCCATATGGCGGCGGGGCAGAAA
CCGCGCCAGGTGACGCTGGGGTATCACGAAGAGGAAGGCGTCGTGATGGCGTTTGACGAGGGGACAATAT
CCGATGAGTAG