SecReT6
Protein ID: 152969882
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01329
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1492806..1495325 [+]
Producthypothetical protein
NoteTssI
UniProt IDA6T840
KEGG IDkpn:KPN_01329
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 7.70E-43, Aligned region: 611..752
T6SS_Vgr [PF13296], Evalue: 3.20E-36, Aligned region: 489..592
T6SS_Vgr [PF13296], Evalue: 3.20E-36, Aligned region: 588..617
T6SS_Vgr [PF13296], Evalue: 3.20E-36, Aligned region: 629..654
Phage_base_V [PF04717], Evalue: 1.40E-16, Aligned region: 339..358
Phage_base_V [PF04717], Evalue: 1.40E-16, Aligned region: 389..482
Protein Sequence: 839 a.a.     [Download]
>gi|152969882|ref|YP_001334991.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAP
VAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRE
RHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADKRLHIDVAEFCDSQQGYEKG
LTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDN
YLTAGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLVTA
MHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDR
ARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRN
VLRTPANNKIRLDDERGKEHIKLSTEYGGKSQLNLGHLVDAEKQPRGEGFELRTDSWGAIRAQKGIFISA
DGQAQAQGQVLDMEPAVSNLAEAREQMMSISGDAQKATANPADLQAQITLLEQQLTDLKKSVLLVSAPEG
IALTSGEHLQVSAGHNLIATAGKNADVSVVKNLFIGVGSALSVFVRKLGIRLIANQGPVQMQAQNDLMAL
LARKEISIVSTEDSIEIIAKKRVTINGGGSYITLNASGIESATAGEYRTRAGYYVRREKAQHKPDIAPLA
NAINDGSHNIRYLCTDDNGVPMMNTPYRAFLADGSVLEGVSDGEGYTKLFTSAQIQDVLLHMIPEAINA
 
Nucleotide Sequence: 2520 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1492806-1495325 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGAGTAGCGTTAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCG
GGCTTGATGTGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCAC
CAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCG
GTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTG
AACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTTAA
CCGCTCGCACCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAG
CGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGCCGCGAGCAGGTGA
TGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGCTT
TACCGCCGACAAGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGG
CTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCAT
GCCGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACAT
GAACGCGCAGGTGGATGTCACTCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAAC
TACCTGACCGCGGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGGCTTC
GCCATGAGCGTTATCTGAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGG
ACAGGTGCTGAAGGTCACCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCTGATGGCGTGCTCGTCACGGCG
ATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACG
TCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCAC
CCGGGAAAACGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGCTGTTTGACCGG
GCGCGCTGGGAAACCGGGTTCGAGAGCCTGTGGGTCCGCCAGTCGCGGCCGTATGCCGGAGACACTTACG
GCCTGCACCTGCCGCTGCTGGCGGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCCGACCGGCC
GTATATCGCGGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATTCGCAATGACAAACGTAAC
GTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGACGAGCGCGGGAAAGAGCATATCAAGCTCT
CGACGGAGTACGGCGGCAAGAGCCAGCTGAACCTCGGCCATCTCGTGGATGCTGAAAAGCAGCCGCGCGG
CGAAGGCTTTGAGCTGAGAACCGACAGTTGGGGCGCTATCCGGGCACAGAAGGGTATTTTTATCAGCGCG
GACGGACAGGCGCAGGCTCAGGGGCAGGTGCTGGATATGGAGCCGGCGGTCAGCAATCTGGCCGAAGCCC
GGGAGCAGATGATGTCCATCTCCGGTGACGCGCAGAAGGCGACCGCGAACCCGGCCGATCTCCAGGCGCA
AATTACCCTGCTGGAGCAGCAGCTGACAGACCTCAAAAAATCGGTACTGCTGGTCAGCGCGCCGGAGGGG
ATAGCGCTGACCAGCGGGGAGCATTTGCAGGTCTCAGCCGGGCATAACCTGATTGCCACAGCCGGAAAGA
ATGCAGACGTCAGCGTGGTGAAAAATCTGTTCATCGGGGTGGGCAGTGCGCTGAGCGTGTTTGTGCGAAA
GCTTGGGATCAGGCTGATAGCGAACCAGGGACCGGTACAGATGCAGGCGCAGAATGACCTGATGGCGTTG
CTTGCCCGGAAGGAAATCAGCATTGTCAGCACGGAAGACAGTATCGAAATTATTGCGAAAAAACGGGTCA
CGATAAACGGCGGGGGAAGTTATATCACGCTCAATGCCAGTGGCATTGAATCAGCGACGGCAGGTGAGTA
CAGAACAAGGGCCGGGTATTACGTCAGGCGGGAAAAAGCGCAGCATAAGCCTGACATTGCACCTTTAGCT
AATGCGATAAATGACGGCAGCCATAATATTCGCTACCTGTGTACAGATGATAATGGGGTGCCGATGATGA
ATACTCCTTACAGGGCCTTTCTGGCTGATGGCTCGGTATTAGAGGGTGTCAGTGATGGCGAGGGGTATAC
GAAGTTGTTTACTTCTGCACAGATACAGGATGTTCTGCTGCATATGATACCGGAGGCCATCAATGCCTAA