SecReT6
Protein ID: 152969896
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01343
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1508599..1510197 [+]
Producthypothetical protein
NoteTssA
UniProt IDA6T854
KEGG IDkpn:KPN_01343
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.60E-21, Aligned region: 68..126
ImpA-rel_N [PF06812], Evalue: 5.60E-21, Aligned region: 302..314
Protein Sequence: 532 a.a.     [Download]
>gi|152969896|ref|YP_001335005.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLAPISDAQPTGDDPGYDDDFQRIREEVNKISGVDTVLI
CQLAGQLLATTKDIRIVTYYCWARLHQDGEAGLADGLELLAGLLQRYGMQLYPQRDRSRKAALEWLAGTR
ILDSLSLFPEVVREDARRTVGALLLIDDCLTTEPETSRPDLQALWGALESRLIKGGGVDAVVPQNVGNRG
LAQTASRMAEYEAPVLSNITSGQDLLAQARTLTAYLRVQPDGWLAAHRLMKSLRHDTLTIIPAPDAEGKT
RIEPPRADQRAMLKRLYLQQSWSEILEQADSTFSRGANHLWLDLQWYIHQALVRSGQDVLADIIIADLKG
LLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMSVWQDEPVSAASGADNDILALEPEALEKADTDGL
DAALHWIQTRPGTESTKEKWLLRLLMARVAEQKGKNDLALYLLRELDDAAGSITLTQWIPALLFEIKSRR
LRLLRMKATRSESEKLRLQPEMDQLLAGLIALDPASSAVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1508599-1510197 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGAGCATTTTACAAAATTTGGTTGCCGCCAGTCAGTTGGATGAAAGCGTACTGCGCCAGCAGGCCCGGT
CACGTCAGGCGCAGTGGCAGTCCTGGCTTGCGCCAATCAGTGACGCCCAACCAACCGGGGACGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGAGGAGGTCAATAAGATCTCCGGTGTCGATACCGTACTGATT
TGCCAGTTGGCTGGACAGTTACTGGCAACAACAAAAGATATCCGGATTGTTACCTATTACTGCTGGGCCC
GTTTGCACCAGGACGGGGAAGCTGGCTTGGCCGATGGGCTGGAGCTGCTGGCAGGCTTGCTGCAACGATA
TGGTATGCAGCTTTATCCGCAGCGCGACCGTAGCCGCAAAGCAGCCCTCGAGTGGCTGGCGGGTACTCGT
ATCTTAGACAGTCTTTCACTTTTTCCAGAAGTTGTGCGGGAGGACGCAAGGCGTACCGTCGGCGCGCTGC
TTCTCATTGATGATTGTCTGACGACAGAACCAGAAACATCACGGCCAGATCTGCAAGCACTCTGGGGTGC
TCTGGAGTCTCGTTTGATAAAGGGCGGGGGAGTCGATGCGGTGGTGCCGCAGAACGTCGGAAACCGGGGG
CTGGCTCAAACCGCTTCACGCATGGCTGAATACGAAGCGCCGGTTCTCAGTAACATCACCTCCGGTCAGG
ATCTGCTGGCCCAGGCGCGAACCCTGACAGCATATCTGCGTGTTCAACCCGATGGCTGGCTTGCCGCACA
TCGGCTAATGAAAAGCCTTCGTCATGACACCTTGACAATCATCCCTGCGCCTGATGCTGAAGGAAAAACA
CGTATCGAGCCTCCCAGAGCAGATCAGCGTGCCATGCTCAAGCGGCTGTACCTGCAACAGAGCTGGTCGG
AGATACTGGAACAGGCGGACAGTACCTTCTCACGTGGCGCTAACCACCTCTGGCTTGACCTGCAATGGTA
TATCCATCAGGCGCTGGTGAGGTCGGGTCAGGATGTGCTGGCCGATATTATAATTGCCGATCTGAAAGGA
TTGCTGCGCCGTCTCACCGGGCTTGAAACATTAGCTTTTAACGACGGCACACCCTTTGCCGATGAGGTCA
CGCTGAACTGGATAAATCAGAGTGTACTCGACGATATGTCCGTCTGGCAGGATGAGCCAGTATCGGCTGC
CAGCGGCGCTGATAACGACATTCTGGCCCTTGAACCTGAAGCGCTCGAGAAGGCTGACACTGACGGTCTC
GATGCTGCACTCCACTGGATTCAGACGCGCCCGGGCACTGAATCCACTAAAGAAAAATGGCTGTTGCGCC
TGCTGATGGCCCGCGTGGCCGAACAAAAGGGGAAGAATGACCTCGCGCTCTATCTTCTGCGAGAACTCGA
CGATGCGGCGGGATCAATCACCCTCACGCAGTGGATCCCAGCCCTGTTGTTCGAGATTAAATCGCGACGG
CTCAGGCTACTGCGCATGAAAGCCACGCGCAGCGAGAGTGAAAAGTTACGATTGCAACCGGAGATGGATC
AATTGCTGGCAGGTCTGATTGCGCTCGATCCAGCCAGTAGCGCGGTGCTTTGCGGCTAA