SecReT6
Protein ID: 152969897
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01344
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1510228..1511283 [+]
Producthypothetical protein
NotePAAR
UniProt IDA6T855
KEGG IDkpn:KPN_01344
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 3.50E-29, Aligned region: 193..304
PAAR_motif [PF05488], Evalue: 2.70E-09, Aligned region: 10..74
Protein Sequence: 351 a.a.     [Download]
>gi|152969897|ref|YP_001335006.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MAAKGFYLVQGDRTTCGGRITTGAEDHTLFDKPVAREQDSVTCGKHAGLYKIAGGIDNDTIHGRRMAGTL
DSCSTCPCKAKFIPSMMNDTYEKGGECITTLFSLDGLMASLQEPYKNLHPENKTERQCTHTDGAIKVAEY
ILSEIKANVRSDMAETIRYLIDEDFIIKRLTEWNKLPFYARLGPPPKADLLAAMAIWYQTVKTGSIWDHK
PKIRDFFSSVAVARPLPRKGKSSKSYYHKFKRHDYFYDVWSNIHYGYVGRSVGFSEAILLKGSTWEQNMT
PGAMGDDTMDDITSMKIGFNLFYEHGKFAETLTADNILCVLETTPGAHLPHSRENHWCWNTDNPEKSDES
F
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1510228-1511283 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGCAGCAAAAGGTTTTTATCTGGTACAGGGAGACAGAACGACCTGCGGCGGAAGAATCACTACAGGCG
CAGAAGATCACACTCTGTTTGATAAACCTGTTGCCCGGGAGCAGGACAGCGTCACTTGCGGAAAGCACGC
AGGGCTATACAAGATTGCCGGTGGCATCGACAACGATACCATTCATGGCCGGCGAATGGCCGGAACCCTC
GACAGCTGTAGTACTTGCCCCTGTAAGGCGAAGTTTATTCCATCAATGATGAATGATACTTATGAGAAAG
GAGGTGAATGCATAACTACTTTATTTTCACTCGATGGGCTTATGGCATCTTTACAGGAACCCTATAAGAA
TCTTCATCCAGAAAATAAGACTGAACGACAGTGTACTCACACAGATGGGGCGATTAAAGTTGCAGAATAT
ATACTAAGTGAAATAAAGGCGAATGTCAGAAGCGATATGGCAGAAACAATACGATATTTAATCGACGAAG
ATTTTATAATAAAAAGACTTACTGAATGGAATAAACTTCCCTTTTATGCAAGGCTGGGGCCGCCCCCTAA
AGCAGATTTACTTGCTGCAATGGCTATTTGGTATCAGACCGTGAAAACAGGTTCAATCTGGGATCATAAA
CCGAAGATCCGCGATTTTTTTTCATCCGTTGCAGTAGCACGACCACTTCCCAGGAAAGGAAAATCATCAA
AGTCTTATTATCATAAGTTTAAACGGCATGATTATTTTTATGATGTTTGGTCAAACATACATTATGGTTA
TGTTGGACGTAGTGTCGGTTTTTCTGAAGCAATTCTCTTGAAAGGGTCCACTTGGGAACAAAACATGACG
CCAGGTGCCATGGGGGATGATACCATGGATGACATTACTAGCATGAAAATAGGGTTTAATCTATTTTATG
AACATGGGAAATTTGCTGAGACGTTGACGGCAGATAATATTCTTTGCGTTTTAGAAACAACACCTGGCGC
GCACCTTCCTCACTCAAGAGAAAATCATTGGTGCTGGAATACAGATAATCCAGAAAAAAGTGACGAATCA
TTTTGA