SecReT6
Protein ID: 152970794
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02247
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2462169..2463584 [-]
Producthypothetical protein
NoteTssA
UniProt IDA6TAQ2
KEGG IDkpn:KPN_02247
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|152970794|ref|YP_001335903.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQHLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPL
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSA
GALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2463584-2462169 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGC
GCCCGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGG
GGAAAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTGCTCCAGCACCTTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGC
TACTGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCCGGCACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCACTG
CCAGACCTAAAACGTAGACCAAAGGCTGAACCGCTGGCTCCGCCTTCACCTGCAAAGCGGCCCGCGCCGG
TGGCGGCGTCTACTCCGGCAGCCGCGCCGCGCTGGAAGCCGTTTATCGCCGGAATGGTTACCATGCTGGC
GGTAACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACC
CAAAATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGC
AGCGCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCA
CCAGGCCCTTATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCT
GGCGCATTGCCCGCGGAAAATCTTACCGGCTGGTCGGAGGGCATGCAGCAGCTGCAGCGGCTCGCCGACC
AGCTCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGC
CATCACACAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTT
GATCAACCCTGGCCAGCCGCGCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATG
CCCTGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAG
TGAGGCGGTGAAATAA