SecReT6
Protein ID: 152970796
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02249
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2464567..2465613 [-]
Producthypothetical protein
NoteTssG
UniProt IDA6TAQ4
KEGG IDkpn:KPN_02249
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-81, Aligned region: 8..309
Protein Sequence: 348 a.a.     [Download]
>gi|152970796|ref|YP_001335905.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLLGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAV
RVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQ
YLLGLAGLGIPGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPL
TMSVRQPVSLQHRPVMGTYATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQL
CVARRLLPDAQLCCQQEHAVQLGRTALLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2465613-2464567 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGCGCAGCTCCGGCCTCAGTTGCCGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACC
ATCCGAAGGCGCCGATCATCGGCAGCGGCTGGCTATTAGGTGATGAACCCATACGCTTTCGCCCGCATCC
GGGGATGGGCTTTCCGGCTGGCGAAATCCGCGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTT
CGCGTGACTTTTATGGGACTCTACGGCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGC
AACGGCGGGAAGGCGTCGAGGCCACCGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTA
TTACCGTATCTGGCGCAAATATTCCTACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAG
TATCTGCTGGGCCTGGCGGGGCTGGGCATACCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGAT
TTCTGGCGCTGCTGCCGGTGATGATGCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCT
CCTGGCCCCGGGGACCCGGGCGACGGTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTA
ACGATGAGCGTCCGTCAGCCGGTTAGCCTGCAACATAGGCCAGTGATGGGAACCTACGCCACGGATGTGA
ACGGTCAGGTATTGCTGCAGCTGGCAACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGA
ACTGTTCAGCGACCTGATGGCGCTTCTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTT
TGCGTCGCCCGCCGTTTACTGCCGGATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCC
GTACCGCTCTGCTGCGTCCTCTGGATGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCG
CTATCAGCGCGTCCGGGAAAATATCCACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA