SecReT6
Protein ID: 152970797
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02250
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2465613..2467376 [-]
Producthypothetical protein
NoteTssF
UniProt IDA6TAQ5
KEGG IDkpn:KPN_02250
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.80E-184, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|152970797|ref|YP_001335906.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IEEAVMTAEPDGRSALRLRFACSELADWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2467376-2465613 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGACGATTTAACCCTGCGATATTTTGACGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTAGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACTATTCCATCGCTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCGATGAAGATGGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGAGGAGGCGGTGATGACGGCGGAGCCGGACGGACGTTCGGCCCTGCGACTACGATTCGCCTGTAGCG
AGCTGGCTGACTGGTCGCAGACCGATCTCCGCCGCCTGGCGCTGTACCTGGGGGAAGACGCCGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGGCTGGAGAGCGAATACCTCCTGCGTCCGAAGCG
CTTGCAGGACGGGCATACCGAAATCTATTCTGTTGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCA
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGGGGAATGATGCGTCGCCATGCGCCGGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAAGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTTAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGCTTCCTGCTGCGCGGGCTGGATATCGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGACATGCTCAACCGCTTTTTCGCACTGTATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA