SecReT6
Protein ID: 152970820
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02273
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2485829..2488315 [-]
Producthypothetical protein
NoteTssI
UniProt IDA6TAS8
KEGG IDkpn:KPN_02273
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-64, Aligned region: 35..355
DUF2345 [PF10106], Evalue: 5.60E-55, Aligned region: 605..759
T6SS_Vgr [PF13296], Evalue: 4.60E-33, Aligned region: 487..593
Phage_base_V [PF04717], Evalue: 1.40E-15, Aligned region: 387..482
Protein Sequence: 828 a.a.     [Download]
>gi|152970820|ref|YP_001335929.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVVTAFRRISSSEDQSKYQITLEPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGTESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDPDRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAELRTDKWVSIRGGAGVFISAD
KQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALPSDTGNQQTLNDALKELAQPGIVLNAPQGVS
ISSPQAVRLSSGSACVGIVSQQNTDISALKRFTVAAGEAVSLLARKAGMKLFAAKGKIEIQAQDDALEAT
AKKDITVTSVEGRVEITAAEELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKMGKADFRVPPLELPE
GFEGRFTVKDQKTGDIVPFARYRITTEKGQVFEGRADADGKTASVYTALPESIKIELL
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2488315-2485829 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGATACCTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGGGCAGAAAAACTGAGTGAACTTTATTATTACACTATTACGTT
TACCAGCGCAGAGAAAAATATTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGCGCACTGCAGCAGCTGGCGGACTGCAAACGCGTCCATGGCGTGGTGACTGCCTTCCGGCGTATCAGCA
GTTCAGAAGATCAGTCGAAATATCAGATAACCCTCGAACCCTTCCTCTCCTTACTGGATAAACAGTTTCG
CAGCCACCGTTTTTTCGTCAACAAATCGGTGCCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTG
CATGACTGGGAGTATGAGTTTAATCTCAAGCAACACTATCCGCGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCATTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCGCAGAGCGAAGTGGTTCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAAACACTTCCT
GTAAACAGCCCGTCCGGGATGAGCGACAGCGGTACGGAATCGATATGGGGTCTGAGCATCACGCACAATG
TCGTAGAGGCGAACGTCACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGATATGACCCGGGGAAATGGGGAAGGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGATCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GACCGTTACCGACAGCCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACC
GGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGTCCCTGCTTGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAA
AGCGAATGATATCTACGCCTGGCAGGATGCGTCCGGCCTGTACCGGGTGAAATTTGACCCTGACAGAGAT
GAGAAAGGGCAGGGTCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGTT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTA
TATTGCGCATGCGCTGCACGACTCGCGGCATGTCGATCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGACAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGCTGAACCTGGGGCATAACGTGAATGCGCAAAGGGAGTTGCGGGGCGA
GGGTGCGGAACTGCGTACGGATAAATGGGTGAGCATCCGGGGCGGTGCGGGAGTGTTTATCAGTGCGGAT
AAACAGCCTTCGGCAGGCGACAGGATGCTGGCAATGGAGGAGGCGATTGCGCAGCTTGAAAATGCCCTGG
GTATTGCGAAAAGCCTGGCGTCGGCAGCGGAATCGGCTCAGGCCCTGCCATCGGATACCGGCAACCAGCA
GACGCTGAACGATGCGCTGAAAGAGCTGGCGCAGCCGGGGATAGTGCTGAATGCGCCGCAGGGCGTGAGC
ATCAGCAGTCCGCAGGCGGTACGGTTGTCTTCGGGTAGCGCCTGCGTGGGGATTGTGTCACAGCAGAATA
CGGACATTAGTGCGCTGAAACGTTTTACGGTGGCGGCGGGAGAAGCCGTCAGCCTGCTGGCGCGAAAGGC
GGGGATGAAGCTGTTTGCGGCGAAGGGAAAGATTGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGACG
GCGAAAAAGGATATCACCGTGACCAGCGTGGAAGGGCGAGTGGAAATCACGGCGGCGGAGGAACTGGTGG
TGAATTGTGCGGGAGCGTATATCAGGCTAAGTGGTGGCAATATCGAGCTGGGCTGCCCTGGGAATATTCT
GCTGAAATCGGCCAATGTGCAGAAAATGGGTAAGGCGGATTTTCGGGTGCCTCCGCTGGAACTGCCTGAA
GGGTTCGAAGGGCGTTTTACTGTCAAAGATCAAAAGACCGGTGACATTGTGCCATTTGCCCGTTACCGCA
TCACCACTGAAAAAGGCCAGGTATTCGAAGGCCGGGCAGATGCTGATGGGAAAACGGCCAGCGTTTATAC
CGCATTGCCTGAATCAATAAAAATAGAGCTACTGTGA