SecReT6
Protein ID: 152970822
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02275
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2491125..2492492 [-]
Producthypothetical protein
NoteTssK
UniProt IDA6TAT0
KEGG IDkpn:KPN_02275
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-130, Aligned region: 27..452
Protein Sequence: 455 a.a.     [Download]
>gi|152970822|ref|YP_001335931.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKVKGTGGAMKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNA
TRLIVRFADGTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTV
QELAGHERSELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELG
ELLHRLQARRRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLA
GSLLTFSLEHHLEAIPRYRHASPEQVFPPLFALLDMLLEVSLPSRVIAIALEQGADREIWRGRLHDARLR
EGADFYLSVRSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDL
STDAARAMLEAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2492492-2491125 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGAAAGTGAAAGGCACAGGAGGTGCAATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGG
TCCCGCAGCAGTTTCAGCAACAGGCCCGCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCT
CGCCCACCCGTGGGGGGTATTGCGCGCGGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCT
ACCCGGCTGATCGTGCGTTTCGCCGACGGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGG
TCCGCGATGTATCGGACGTGATGCAGGACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAG
CGGCGGCAATCTTGATGACGGCCAGGAGAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTC
CAGGAGCTGGCCGGCCATGAACGCAGCGAGCTGGCCGTTCTGCGACACGCGCTAACGCTGCGTCTCTCCA
CCGAGGAAAATGCAGCCTTCCTCACCTGCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGAT
CGTTGACCCGGAATTCATCCCGCCGCTGCTGTCGCTGGCGGCAAGCCCGACGCTGGTTAGCGAGCTGGGC
GAGCTGTTACATCGCCTGCAGGCCCGACGCAGACGCCTGATGGCCATGCGCCGTGAAAGCAATGCGCGGA
TGGCTGATTTTGCCGTGGCGGATGTTTCCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGT
GCTCAGCGAGCTGCATCAGGACCCTTCGCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCC
GGCAGTCTGCTGACTTTCTCCCTTGAACATCATCTGGAAGCAATCCCCCGCTACCGACATGCCTCGCCAG
AGCAGGTATTCCCGCCGCTGTTTGCCCTGCTGGATATGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGAT
CGCCATCGCTCTGGAGCAGGGCGCCGACCGGGAGATCTGGCGGGGCAGGCTACACGATGCGCGGCTGCGC
GAGGGGGCGGATTTTTATCTGTCGGTGCGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGC
AGCTCTGTAAGGCGGGTAGCCATGATGATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGAT
CAAACCGCTGAGCCATGTGCCGGCGGCCATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTC
TCCACCGATGCCGCCCGCGCGATGCTGGAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCG
ACGTGAAACTTGAACTCTTTGCGGTACTGCGCTCATGA