SecReT6
Protein ID: 152971687
SecReT6 ID215
T6SS typeN/A
Gene symbol-
Locus tagKPN_03168
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]3476167..3477507 [+]
Producthypothetical protein
NoteTssK
UniProt IDA6TD95
KEGG IDkpn:KPN_03168
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-132, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|152971687|ref|YP_001336796.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLKLRTLRLRFSD
GSLIDSEVSDALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTERPLRYRQEWHKVQDIYGSDS
EEMAVECHALSLRFAHDNNQDYITCPLARLTRNGQGNWSQDESYIPPLLALSAHIGLVERLDTLLLQLQA
KCRRLMALRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSL
EHNVSAIPAYVHDAPASVFPPLFTLLSELLEASLPSRVIALELESLPGNRWKAELHDPRLREEADFYLSV
RSSLPTHVVLQQLPRLCKIGAPDDVTLLVNVALNGVPVVPLTQVPAALPLRLENQYFALDMQSAPAKAML
DAGCCMIYAPGTLGDLKPELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|152968582|ref|NC_009648.1|:3476167-3477507 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGAAAATTCATCGACCACTATGGGCTGAGGGAACGTTCCTGTCCTCACAACAGTTTCAGCAGCAGGCCC
GCTGGGAAACGTACAGTAACAACAGCATTGCACAGCTGGGTATCCGTCATCCATGGGGTGTGGCGAGAGT
CGAGTTTGACAGAGAAGCGTTGGCGTTAGGGAAGTTAAAATTACGTACCCTGCGCCTGCGTTTTTCCGAT
GGCTCGTTGATCGACTCCGAAGTTTCCGATGCGCTGCCTCTGGCTTGTGATTTACATACTCTGGCGGTGG
AAAATACGGCAATAGTTGTCCTGGCGTTACCGCTGGAACATGCGAATGGCGGTAATCTGGGACAGGAAAA
GCATACTGAAAGACCCCTGCGTTATCGTCAGGAATGGCATAAAGTACAGGATATTTATGGCAGCGACAGT
GAAGAAATGGCCGTTGAATGCCATGCGCTGTCATTGCGTTTCGCCCATGATAACAATCAGGATTACATCA
CCTGCCCGCTTGCACGTCTGACGCGGAATGGTCAGGGTAACTGGTCTCAGGATGAAAGCTACATCCCGCC
GCTGCTTGCCCTCAGCGCACATATTGGTCTGGTGGAGCGACTGGATACGTTGCTGTTGCAGCTACAAGCG
AAGTGCCGGCGTCTGATGGCCCTGCGCCGGGAAAGCAATCAGCGTATGGCGGACTTCGCGGTAGCGGATG
TGTCCCTGTTCTGGTTACTCAATGCGTTGAACAGCGCTGAACCGGTTCTAAGTGATTTTTTACGGTATCC
GAGCATCCATCCTGAACTCGTCTGGCGCGAACTGGCTCGTCTGGCCGGCGCGTTGCTGACCTTTTCCCTT
GAACACAACGTGAGCGCCATTCCCGCATATGTCCATGATGCTCCAGCCTCCGTTTTTCCGCCGCTTTTTA
CCCTGCTCAGCGAACTGCTCGAAGCCAGCCTGCCGTCGCGGGTGATTGCGCTCGAGCTGGAATCCCTTCC
CGGCAACCGCTGGAAAGCCGAACTTCACGATCCACGCCTGCGGGAAGAGGCGGATTTTTACCTTTCTGTT
CGCTCCTCGCTGCCGACGCACGTCGTTCTGCAACAGTTACCACGGCTCTGCAAAATCGGGGCGCCGGATG
ACGTTACGTTGTTGGTTAATGTTGCGCTGAACGGTGTCCCTGTTGTTCCGCTGACGCAGGTTCCGGCTGC
ATTGCCATTACGGCTGGAGAATCAGTACTTTGCGCTGGATATGCAGAGCGCTCCGGCTAAAGCCATGCTG
GATGCCGGGTGCTGCATGATTTACGCGCCGGGTACGCTGGGCGATCTGAAACCCGAGCTTTTTGCGGTAC
TGCGGTCATGA