SecReT6
Protein ID: 152971689
SecReT6 ID215
T6SS typeN/A
Gene symbol-
Locus tagKPN_03170
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]3480091..3482646 [+]
Producthypothetical protein
NoteTssI
UniProt IDA6TD97
KEGG IDkpn:KPN_03170
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.00E-61, Aligned region: 31..347
Phage_GPD [PF05954], Evalue: 5.00E-61, Aligned region: 766..799
DUF2345 [PF10106], Evalue: 9.10E-45, Aligned region: 597..751
T6SS_Vgr [PF13296], Evalue: 9.90E-38, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 2.50E-13, Aligned region: 392..473
CbiD [PF01888], Evalue: 0.0094, Aligned region: 554..669
Protein Sequence: 851 a.a.     [Download]
>gi|152971689|ref|YP_001336798.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDVQNFDHSHHALKIRGLSSGVDVLSFEGKEQLSAPFRYDIQFTSSDKSIAPESVLMQDGAFSLTAPPVQ
GIPTQTPLRTLYGVITGFKQLSSSRDEARYEVRLEPRLALLSRSHQNAIYQNQTVPQIVEKILRERHEMR
GQDFVFNLKGDYPSREQVMQYDEDDLTFISRLLSEVGIWFRFSTDARLKIGVIEFYDDQSGYERGLTLPL
RHPSGMSDSGTEAVWDLNTAYSVVSRSVTTRDYNYREAMAEMTTGQFDVTGGDNTTYGEAYHYADNFLKT
GDKATPESGAFYARIRHERYLNGRAILKGQSTSSLLMPGLEIKVEDNDAPEVFRKGILITGITASAARDR
SYELTFTAIPYSERYGYRPPLIRRPVMAGTLPARVTSTTANDVYAHIDKDGRYRVNLDFDRDTWKPGFES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEDGRPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAIRAKKGVFISADAQEKAQGQ
ALDMQAAITQLENALSIAKSLSQAAEVAKAHGADLDGHTSLNGALSELVKAGIVLSAPEGVGIVSPQGVR
LGSGESSIGLMAGTNIDAGAMEKVTVSAGDAVSVFARKGGIKLYANQGKVEVEAQNERMRLTSRHGMKIS
STEDVVEIEAEKELVLKCGKAYIRLSGGGVEVGGPKNILLKSANVQKMSKAQLPVEMPVLPGKGNYDLSL
DLRDWDGIPIGGAKYTIAFESGAVLSGMLDDKGYALHTNVPPESATVEYEFPEPEPDKPWDPYSSLLASV
DAELGTDGQGA
 
Nucleotide Sequence: 2556 bp     [Download]
>gi|152968582|ref|NC_009648.1|:3480091-3482646 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGATGTACAGAACTTCGACCACTCACACCACGCGTTAAAAATCCGCGGCCTGAGCAGCGGCGTGGACG
TACTGTCCTTTGAAGGCAAGGAGCAATTAAGCGCCCCATTCCGCTATGACATTCAGTTTACCAGCAGCGA
TAAGTCTATTGCGCCGGAGTCGGTGCTGATGCAGGACGGGGCATTCAGCCTGACCGCCCCGCCGGTGCAA
GGGATACCGACGCAGACTCCCCTGCGTACGTTGTACGGGGTGATCACCGGATTTAAGCAATTGTCTTCCT
CACGGGACGAGGCGCGGTATGAGGTGCGGCTGGAGCCCCGTCTGGCGCTACTGTCCCGCAGCCATCAGAA
CGCGATTTATCAGAACCAGACGGTGCCGCAAATCGTGGAGAAAATACTCCGCGAGCGGCATGAGATGCGC
GGTCAGGACTTTGTGTTTAACCTGAAAGGCGACTACCCGTCACGCGAGCAGGTCATGCAGTACGACGAAG
ACGATCTGACATTCATCTCACGGTTGCTGTCGGAGGTGGGTATCTGGTTCCGGTTCAGTACCGACGCCCG
ACTGAAAATCGGGGTTATCGAGTTTTACGACGACCAGAGTGGCTATGAGCGCGGCCTGACGCTGCCGCTG
CGTCACCCTTCGGGGATGAGCGACAGCGGAACCGAAGCAGTGTGGGATCTGAACACGGCCTACAGCGTGG
TATCGAGGTCCGTCACGACGCGGGATTACAACTACCGTGAAGCGATGGCGGAGATGACAACAGGCCAGTT
TGACGTAACAGGCGGGGATAACACCACCTACGGTGAAGCCTATCATTACGCTGACAATTTTCTGAAAACG
GGTGACAAAGCGACGCCGGAGAGTGGTGCATTCTATGCGCGTATCCGCCACGAACGCTACCTGAACGGAC
GCGCCATCCTGAAGGGACAGAGCACCAGTTCTCTGCTGATGCCGGGGCTGGAGATAAAGGTCGAGGATAA
TGATGCGCCAGAGGTATTCCGCAAGGGCATTCTGATAACCGGGATTACCGCCAGCGCAGCACGAGACCGC
AGTTACGAACTGACATTCACCGCCATCCCCTATTCCGAACGCTACGGCTACCGCCCTCCTCTCATCCGCA
GGCCTGTGATGGCTGGGACACTCCCGGCGCGGGTGACCAGCACCACGGCAAATGATGTCTACGCTCATAT
CGACAAAGACGGGCGCTATCGAGTGAACCTGGACTTTGACCGGGATACGTGGAAGCCGGGTTTCGAGAGC
CTGTGGGTACGGCAGTCACGCCCCTATGCGGGAGATACTTACGGTCTGCACCTGCCGCTGCTGGCGGGAA
CCGAGGTTAGCATCGCGTTTGAGGATGGCAGACCGGACAGGCCATATATCGCCGGGGTGAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTATAAGCGCAACGTGCTGCGCACCCCGGCGAATAACAAA
ATCCGGCTGGACGATGAGCGGGGTAAGGAGCACATCAAGGTCAGCACAGAGTACGGCGGAAAGAGCCAGC
TGAACCTGGGACATCTGGTGGATGCTGGGAAGCAGCAACGCGGTGAGGGTTTCGAACTGCGCACCGATAT
GTGGGGTGCGATAAGAGCGAAAAAAGGTGTCTTTATCAGCGCCGATGCGCAGGAAAAGGCGCAGGGGCAG
GCGCTGGATATGCAGGCAGCAATAACGCAACTGGAAAATGCGTTATCGATAGCAAAAAGTCTGTCACAGG
CGGCGGAGGTGGCGAAGGCGCATGGTGCGGATCTTGATGGGCATACGTCGCTGAACGGCGCGCTGTCGGA
GCTTGTAAAGGCAGGGATAGTGCTGAGCGCGCCGGAAGGCGTGGGGATTGTAAGTCCACAGGGCGTCAGA
CTGGGTTCGGGAGAGAGCAGTATAGGGCTGATGGCGGGAACAAATATTGATGCAGGGGCGATGGAGAAGG
TGACTGTCTCGGCGGGAGACGCGGTGAGTGTATTTGCGCGCAAGGGAGGGATAAAGCTGTACGCAAACCA
GGGAAAAGTTGAAGTGGAGGCTCAGAACGAGAGAATGCGGCTGACATCGCGCCATGGGATGAAGATAAGC
AGTACGGAAGATGTGGTGGAGATAGAGGCAGAGAAGGAACTTGTGCTGAAATGCGGCAAGGCGTACATCA
GGCTGAGCGGCGGCGGGGTGGAGGTAGGAGGACCGAAGAATATCCTGTTGAAATCAGCGAATGTGCAGAA
GATGAGTAAAGCGCAGTTGCCGGTTGAGATGCCTGTGCTGCCGGGAAAAGGTAATTACGATCTGTCGCTG
GATCTGCGGGACTGGGATGGTATTCCCATTGGTGGCGCGAAGTACACAATCGCTTTTGAGTCAGGGGCTG
TATTGTCGGGCATGTTAGATGATAAAGGGTACGCACTGCATACCAATGTTCCCCCCGAATCAGCAACGGT
GGAATACGAATTTCCAGAGCCGGAACCGGACAAACCTTGGGATCCCTATTCGTCCCTGCTTGCCTCAGTA
GATGCTGAATTAGGGACGGATGGACAGGGAGCATAA