SecReT6
Protein ID: 152971698
SecReT6 ID215
T6SS typeN/A
Gene symbol-
Locus tagKPN_03179
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]3493264..3495024 [+]
Producthypothetical protein
NoteTssF
UniProt IDA6TDA6
KEGG IDkpn:KPN_03179
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-180, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|152971698|ref|YP_001336807.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELLTDHRQMKQSETLSDFQVLSRPVGEHRTRCCYSATRDITLLPLAL
PEVSLQYEQDGRSVIRLRFECSPLAGDGSQIDLSRLPLYLNADSPLACALHRALTLGVQQIWFRLPGEER
RTLDGYFSPMGFGKDDPLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVVWPAGMSGFEIDVVLAE
SWSHDLPFSTENIRLHCVPVINLFPLEADPLHLSPLENEYLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDSPERYYHTRVKRGPSGLHDTWLILGGDAFDIDRLLEDETLSLSLTGTNGQLPR
KALQSTVLDTPVYATQHTLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMENAEILRGTLALYDW
TESEMNRRRLEAIVDVQHHLIQRFEKGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|152968582|ref|NC_009648.1|:3493264-3495024 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGACGACCTGACCCAACGCTATTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAGTTTG
CACAAGCGTATCCTGATCGCGCCGCTATGCTCAATCTCGATAAGCCCGGCGCGCGCGACCCTTATGTCGA
ACGTCTCTTCGAAGGTTTCGCCTTCCTGATGGGCCGCCTGCGGGAAAAACTGGATGACGATCTACCTGAA
CTGACTGAGGGGCTGGTGAGCCTCCTGTGGCCTCATTATCTGCGTACAATCCCGTCGCTGTCGGTGGTGG
AACTGTTAACCGATCATCGGCAAATGAAGCAGAGCGAAACACTGAGTGATTTTCAGGTGCTCTCGAGGCC
CGTCGGCGAACACCGGACACGTTGCTGCTACAGCGCCACGCGGGATATCACCCTGCTTCCGCTGGCTTTA
CCAGAGGTGTCGTTACAGTACGAACAGGATGGACGCTCGGTTATCCGTCTGCGCTTTGAGTGCAGCCCGC
TGGCTGGCGACGGGTCACAGATTGATTTATCGAGACTGCCGCTCTATCTCAATGCGGACAGTCCGCTGGC
TTGTGCATTACACCGGGCGCTGACGCTGGGGGTGCAGCAAATCTGGTTTCGCCTGCCGGGGGAGGAACGT
CGGACACTGGACGGCTATTTTTCCCCGATGGGGTTCGGTAAGGACGATCCGCTCTGGCCAAAAGGCGAAT
CGGCCTTCAGCGGCTACCAACTACTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTCGCCCT
CAACGGGCTGGAGAATGTGGTCTGGCCGGCAGGAATGAGTGGATTCGAAATTGACGTGGTGCTCGCGGAA
AGCTGGTCTCACGATCTGCCGTTCAGCACCGAAAATATCCGCCTGCACTGCGTACCGGTGATCAACCTGT
TCCCGCTGGAAGCCGATCCACTGCATCTTTCTCCGCTGGAAAATGAATACTTGCTGCGCCCCATGCGTAT
TCAGGACGGGCATACGGAAATTTACTCCGTCGATAATATTATTTCTTCGCGACACACCGGCAGTCAGGCA
TATGTGCCCTTTTCCAGTTTTCGCCACCGGGGCGGGATGTTGCGTCACGATTCGCCGGAACGTTATTACC
ATACGCGGGTAAAACGCGGCCCTTCCGGTTTGCATGATACCTGGCTGATCCTTGGGGGCGACGCATTCGA
TATCGACCGCCTGCTGGAAGACGAAACCCTGTCCCTGAGTCTGACCGGCACCAACGGTCAGCTTCCGCGT
AAAGCGCTGCAGAGCACGGTGCTGGACACCCCCGTCTACGCCACGCAGCATACACTGCGGGTGCGCAACC
TGTGCGCGCCGACGCAGCCCTGTTATCCCCCGGCGCGTGACCGTTTCCACTGGCGGGTTCTCAGCCACTT
AGGCTCCAACTTCCTGTCAATGATGGAAAACGCCGAAATCTTGCGCGGCACGCTGGCGCTGTACGACTGG
ACGGAAAGCGAAATGAACCGACGCCGTCTGGAGGCAATCGTTGACGTTCAGCATCACCTGATTCAGCGTT
TTGAAAAAGGTTTTCTACTGCGCGGCGTGGATATTCAGGTCACGCTGGACAGCAACGGTTTCGCCGGCGA
AGGCGATATCACCCTGTTTGGCGAACTGCTGCACCGCTTTTTCGCCCTGTATGCCGACATCCACTTATTT
ACTCAGTTGACGCTGATTCTGCAACCTACAGGAAAATGTTTGCAATGGACAGAACACCACAGCCAGCGCG
TACCGGGCTGA