SecReT6
Protein ID: 152971699
SecReT6 ID215
T6SS typeN/A
Gene symbol-
Locus tagKPN_03180
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]3494988..3496070 [+]
Producthypothetical protein
NoteTssG
UniProt IDA6TDA7
KEGG IDkpn:KPN_03180
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.30E-83, Aligned region: 19..320
Protein Sequence: 360 a.a.     [Download]
>gi|152971699|ref|YP_001336808.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDRTPQPARTGLTERLAPDINRINFYRFCQLLEQSQPQTPLLGSTTNPADDPVRFRPHPGMGFPVSELKS
VEQDLDHPDAPPTVRTTFLGLYGVDSPLPTAYLDYIAQRRDGHEAMMAFLDIFNHRFITQYYRIWRKYNY
LTSFEPGAVDNISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGITALVRLLAPQTQATV
IPHDPQQIVLPEPAGLSKRSGICLKTRALLGNTGTDVNSQLLMKLYTEDDGEARGWLPGGQLHTDLLVLL
RVYLGWRYQARLQLTLPVSLLPPAQLGNQRVQVSRTGVLRASFAAPVAGTVTVSLGRYQGLMPTSSTRDR
ESVTHVSYTL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|152968582|ref|NC_009648.1|:3494988-3496070 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGGACAGAACACCACAGCCAGCGCGTACCGGGCTGACGGAAAGGCTTGCTCCGGACATTAACCGAATTA
ACTTTTACCGTTTCTGCCAGCTTCTTGAACAAAGCCAACCACAGACGCCACTGCTGGGGAGCACAACCAA
TCCGGCAGACGATCCTGTCCGTTTTCGTCCACATCCGGGGATGGGGTTCCCGGTAAGCGAACTAAAAAGC
GTCGAACAGGATTTGGATCATCCTGACGCGCCACCCACGGTGCGCACCACGTTTCTGGGGCTGTACGGTG
TGGATTCACCGCTGCCGACAGCCTATCTCGACTACATCGCGCAGCGCCGGGACGGCCATGAAGCGATGAT
GGCGTTTCTGGACATTTTTAACCATCGCTTTATCACTCAGTACTATCGTATCTGGCGCAAATATAATTAC
CTTACGTCGTTTGAACCGGGAGCCGTGGATAATATTTCCCGCTGCCTGCTGGGGTTGATTGGTCTGGGCA
TTCCCGGCAGCGAAAATCATATCGCCACGCCGGTCTCGCGTTTTCTGGCATTACTCAGCGTGATGCGTCT
GCCGACGCGTACAGCAGAAGGCATAACGGCGCTGGTCAGATTACTGGCCCCCCAGACGCAAGCGACAGTT
ATCCCGCACGATCCACAACAAATTGTCCTGCCTGAACCTGCGGGTTTATCAAAAAGATCAGGTATTTGCC
TGAAAACTCGGGCACTGCTGGGCAACACCGGCACTGACGTTAACAGCCAGTTACTGATGAAGCTGTATAC
CGAAGACGACGGAGAGGCACGCGGCTGGCTGCCGGGCGGGCAACTACATACCGACCTGCTGGTGCTGTTG
CGTGTCTATCTGGGCTGGCGCTACCAGGCCCGCCTGCAACTGACCTTGCCCGTCAGTCTGCTGCCTCCGG
CACAGTTAGGAAATCAGCGCGTTCAGGTAAGCCGAACGGGCGTGCTGCGGGCGTCTTTTGCTGCCCCAGT
CGCCGGTACGGTCACGGTCAGTCTCGGGCGTTATCAGGGACTCATGCCCACATCATCCACCCGCGACAGG
GAGAGTGTTACTCATGTTTCTTACACCCTATAA