SecReT6
Protein ID: 152984171
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2890
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2971838..2974387 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA6V5B5
KEGG IDpap:PSPA7_2890
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-37, Aligned region: 220..296
AAA_2 [PF07724], Evalue: 1.50E-37, Aligned region: 611..775
AAA [PF00004], Evalue: 7.20E-21, Aligned region: 220..350
AAA [PF00004], Evalue: 7.20E-21, Aligned region: 470..497
AAA [PF00004], Evalue: 7.20E-21, Aligned region: 617..734
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 294..350
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 616..735
Clp_N [PF02861], Evalue: 7.10E-12, Aligned region: 21..71
Clp_N [PF02861], Evalue: 7.10E-12, Aligned region: 100..125
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 220..301
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 336..393
AAA_22 [PF13401], Evalue: 2.90E-09, Aligned region: 615..720
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 75..75
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 197..240
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 606..657
AAA_19 [PF13245], Evalue: 2.90E-06, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 2.90E-06, Aligned region: 613..638
AAA_14 [PF13173], Evalue: 6.10E-06, Aligned region: 220..301
AAA_14 [PF13173], Evalue: 6.10E-06, Aligned region: 615..706
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 220..261
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 620..653
ClpB_D2-small [PF10431], Evalue: 1.40E-05, Aligned region: 781..848
Sigma54_activat [PF00158], Evalue: 2.00E-05, Aligned region: 243..262
Sigma54_activat [PF00158], Evalue: 2.00E-05, Aligned region: 615..733
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 220..240
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 610..656
AAA_25 [PF13481], Evalue: 4.10E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 4.10E-05, Aligned region: 274..317
AAA_25 [PF13481], Evalue: 4.10E-05, Aligned region: 613..641
AAA_25 [PF13481], Evalue: 4.10E-05, Aligned region: 787..804
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 214..239
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 616..636
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 220..240
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 620..651
NACHT [PF05729], Evalue: 0.0007, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.0007, Aligned region: 617..641
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 220..266
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 376..423
AAA_28 [PF13521], Evalue: 0.001, Aligned region: 617..636
T2SE [PF00437], Evalue: 0.0012, Aligned region: 209..236
T2SE [PF00437], Evalue: 0.0012, Aligned region: 591..685
ResIII [PF04851], Evalue: 0.002, Aligned region: 207..241
ResIII [PF04851], Evalue: 0.002, Aligned region: 288..301
ResIII [PF04851], Evalue: 0.002, Aligned region: 602..638
MAD [PF05557], Evalue: 0.0047, Aligned region: 428..505
RNA_helicase [PF00910], Evalue: 0.0054, Aligned region: 221..241
RNA_helicase [PF00910], Evalue: 0.0054, Aligned region: 618..638
FtsK_SpoIIIE [PF01580], Evalue: 0.0088, Aligned region: 201..261
FtsK_SpoIIIE [PF01580], Evalue: 0.0088, Aligned region: 451..527
AAA_29 [PF13555], Evalue: 0.0096, Aligned region: 210..236
AAA_29 [PF13555], Evalue: 0.0096, Aligned region: 614..641
Protein Sequence: 849 a.a.     [Download]
>gi|152984171|ref|YP_001348250.1| type VI secretion ATPase [Pseudomonas aeruginosa PA7]
MELAALIGRLNPDCRRALERAAQRCLQRTHHYVEIEHLLLELLDIDGGDFACLLPRFGLERDALVAEINL
SLELFKAGNTRTPALSAHTIGLLEDAVVHASVLGQAQIRSGLLLLALLDREERRALLLNSASSLLRIPHE
ALQANLLEWIQASREQPPAPNRPAAGGDKPESAQDPLLDQYTQDLTAEARAGRIDPIVGRDGEIRQCVDI
LLRRRQNNPILVGAPGVGKTAVVEGLALRIAAGEVPPSLQEVILRVLDLGLLQAGASMKGEFEQRLKGVI
DAVRNSAQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALTRRF
QLVQVEEPDEATAVEMLRGVAGKLEQHHGVQIMDAAIVDAVKLSHRYISGRQLPDKAISVLDTACARVAL
AQHDVPPALENLRHRELAVEEELQRLRREQATGLDHSVRITGLEQESVGNLSAIRALEKRWGEEREAVRE
LLQSRRELLTLSESADAAKPDEELDGRIDHLAAELARLEAGLDAIREDDPLVPEQVDSKTVAAVIAGWTG
IPVGKMLADEAHAIRTLAQRMGQRVMGQEAALGAIAQRIQAYRAGLSDPAKPVGVFLLPGPTGVGKTETA
YALADALYGGERNLISINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPD
VLEAFYNVFDKGVMEDGTGLVVDFRNTVILATSNVGAELLLDSPAEQVATPAFDERLRKVLLQTFRPAFL
ARMTVVPYRPLEEATLEGIVVAKLEKLRERYKAATGKQFDFDPAIVKAVLAKCSAAGARDIENVLMAQVT
GKLAEWALE
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c2974387-2971838 Pseudomonas aeruginosa PA7 chromosome, complete genome
GTGGAACTCGCCGCCCTGATCGGCCGCCTCAACCCGGACTGTCGCCGCGCCCTGGAGCGCGCCGCGCAAC
GCTGCCTGCAACGCACCCATCATTACGTAGAGATCGAGCACCTGCTACTGGAGCTGCTGGACATCGACGG
CGGCGACTTCGCCTGCCTGCTGCCGCGCTTCGGCCTGGAGCGCGACGCCCTGGTCGCCGAGATCAACCTG
TCGCTGGAGCTGTTCAAGGCCGGCAATACCCGCACTCCGGCGCTGTCCGCGCACACCATCGGCCTGCTCG
AGGACGCCGTGGTCCACGCCAGCGTGCTCGGCCAGGCGCAGATCCGTTCCGGCCTGCTGCTGCTCGCCCT
GCTCGACCGCGAGGAGCGCCGCGCCCTGTTGCTGAACAGCGCGTCGTCGCTGCTGCGGATTCCCCACGAG
GCCTTGCAGGCCAACCTGCTGGAGTGGATCCAGGCCTCCCGCGAACAGCCGCCCGCGCCGAACCGTCCGG
CGGCAGGCGGCGACAAGCCGGAAAGCGCCCAGGACCCGCTGCTCGACCAGTACACCCAGGACCTCACCGC
CGAGGCCCGCGCCGGGCGCATCGACCCCATAGTCGGGCGCGACGGGGAGATCCGCCAGTGCGTCGACATC
CTCCTGCGCCGGCGGCAGAACAACCCGATCCTGGTCGGCGCGCCGGGCGTCGGCAAGACCGCGGTGGTCG
AGGGCCTGGCCCTGCGCATCGCCGCCGGCGAAGTGCCGCCGTCGTTGCAGGAGGTGATCCTGCGGGTGCT
CGACCTCGGCCTGTTGCAGGCCGGCGCCAGCATGAAGGGCGAGTTCGAGCAGCGCCTCAAGGGCGTGATC
GACGCCGTGCGCAACAGCGCGCAGCCGATCATCCTGTTCATCGACGAGGCGCACACGCTGATCGGCGCCG
GCGGCGCGGAAGGCGGCAGCGACGCCGCCAACCTGCTCAAGCCGGCCCTGGCGCGCGGCGAGTTGCGCAC
CCTGGCGGCCACCACCTGGCTGGAATACAAGAAATACTTCGAGAAGGACCCGGCGCTGACCCGGCGCTTC
CAGCTGGTCCAGGTCGAGGAGCCGGACGAGGCCACCGCCGTGGAGATGCTGCGCGGCGTCGCCGGCAAGC
TGGAACAGCATCACGGCGTGCAGATCATGGACGCGGCCATCGTCGATGCGGTGAAGCTGTCGCACCGCTA
CATCTCCGGCCGCCAGTTGCCGGACAAGGCCATCAGCGTGCTGGACACCGCCTGCGCCCGCGTCGCCCTG
GCCCAGCACGACGTGCCGCCGGCCCTGGAGAACCTGCGCCACCGTGAACTGGCGGTGGAGGAAGAGCTGC
AACGCCTGCGCCGCGAGCAGGCCACCGGCCTGGACCACAGCGTGCGCATCACCGGCCTGGAGCAGGAATC
GGTGGGTAACCTGTCGGCCATCCGCGCCCTGGAAAAACGTTGGGGCGAAGAACGCGAGGCGGTACGCGAA
CTGCTGCAGTCACGCCGCGAACTGCTGACCCTGAGCGAGAGCGCCGACGCCGCCAAACCCGACGAAGAAC
TCGACGGCCGCATCGACCACCTGGCCGCCGAACTGGCCCGCCTGGAAGCCGGCCTCGACGCCATCCGCGA
GGATGATCCGCTGGTGCCCGAACAGGTCGACTCGAAGACCGTGGCCGCGGTGATCGCCGGCTGGACCGGC
ATCCCGGTTGGCAAGATGCTCGCCGACGAAGCCCATGCCATCCGCACCCTGGCCCAGCGCATGGGCCAGC
GGGTGATGGGCCAGGAGGCCGCCCTGGGCGCCATCGCCCAGCGCATCCAGGCCTATCGCGCCGGACTCAG
CGACCCGGCCAAGCCGGTCGGCGTATTCCTCCTGCCCGGCCCCACCGGCGTGGGCAAGACCGAGACCGCC
TACGCCCTGGCCGACGCCCTCTACGGCGGCGAACGCAACCTGATCAGCATCAACCTCTCCGAGTACCAGG
AGGCCCACACCGTCAGCCAGCTCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCAGCGGCGGCGTGCT
CACCGAAGCGGTGCGCCGCAAGCCCTATTCGGTGGTGCTGCTGGACGAGATCGAGAAAGCCCATCCGGAC
GTGCTGGAAGCCTTCTACAACGTGTTCGACAAGGGTGTGATGGAAGACGGCACCGGCCTGGTGGTGGACT
TCAGGAACACCGTGATCCTCGCCACCAGCAACGTCGGCGCCGAACTGCTGCTGGACAGCCCGGCCGAACA
GGTCGCCACCCCGGCCTTCGACGAGCGCCTGCGCAAAGTCCTGCTGCAAACCTTCCGCCCGGCGTTCCTC
GCGCGCATGACCGTGGTGCCTTACCGGCCGCTGGAGGAAGCCACCCTGGAAGGCATCGTCGTGGCCAAGC
TGGAAAAACTGCGGGAACGCTACAAGGCCGCTACCGGCAAACAGTTCGACTTCGACCCGGCCATCGTCAA
GGCCGTGCTCGCCAAGTGCAGCGCGGCGGGCGCGCGGGATATCGAGAACGTGCTGATGGCGCAGGTGACG
GGGAAGTTGGCGGAGTGGGCATTGGAGTAA