SecReT6
Protein ID: 152984393
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3604
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3731201..3732070 [-]
Producthypothetical protein
NoteTssL
UniProt IDA6V7C3
KEGG IDpap:PSPA7_3604
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-69, Aligned region: 61..266
Protein Sequence: 289 a.a.     [Download]
>gi|152984393|ref|YP_001348958.1| hypothetical protein PSPA7_3604 [Pseudomonas aeruginosa PA7]
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSLNPLVAAASEL
LSEVVRLKHSTVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNESEW
SKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALY
RQIRQLRGDVPRELSPHWQGLSDQRRGLVRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSL
DAAAGQPGS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3732070-3731201 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGATCAAGGAAAGGGAATACCACGAGGACGAGAAGACCGTCCTCCTCGATCACCAGGGACAGGTACCGG
CCCAGGGGCCGCTGACCGATTTCGCCGAACCGCCGCGCTTCGAGCAGCTCGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGTCCGGGCGAAGCCTTCAACGTCAGCCTGAACCCGCTGGTGGCGGCGGCTTCCGAACTG
CTTTCGGAAGTGGTCCGACTCAAGCACAGCACCGTGCTGGAGAACCTTGCGGCGCTCAAGGAGCGGTTGA
CCTCCGCCATGAAGCTCTTCGAATTCCGCGCCGTGCAGGATGGCGTGGAAAACAGCCAGGTCATGGCGGC
GCGCTACGTGCTGTGCACGGTGGTCGACGAGGCGGTGGTGACCACCCCGTGGGGCAACGAAAGCGAATGG
TCGAAGATCAGCCTGCTGAGCAGCTTCCATAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGTTGCTTG
ACCGGCTGTCGAAGAACCCGGTCAAGCATCTGCCGATGCTGGAGCTGATGTACCTCTGCCTGGCCCTCGG
CTTCGAGGGCAAGTACCGGGTGATGGCTCGCGGCGTGCTCGACCTGGACGGTATTTCCGATGCGCTCTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCGCGCGAACTGTCACCGCACTGGCAGGGGCTCAGCGACC
AGCGTCGCGGCCTGGTGCGGATCGTGCCCTGGTGGATGGTGGCGTTGTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGATTCGCCTGGGTTCTCGGCGAGCAACGCGACACGGTGCTGCAGCCATACCAGTCGCTC
GATGCGGCGGCAGGACAGCCCGGTTCGTAA