SecReT6
Protein ID: 152984934
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3611
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3739524..3740531 [-]
Producthypothetical protein
NoteTssG
UniProt IDA6V7D0
KEGG IDpap:PSPA7_3611
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-89, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|152984934|ref|YP_001348965.1| hypothetical protein PSPA7_3611 [Pseudomonas aeruginosa PA7]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREQYPGLGDEALYDQLEFQANPSLGFPASDIDRVE
FFEERGMLRARLRFNLMGLFGSSSPLPAFYSEQALGDSEESNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFSVVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELLAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNPCRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3740531-3739524 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGTTGGCACGGGGTATTCGCGAATACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGTCTGCGCGAGCAATACCCCGGGCTGGGGGACGAGGCGCT
TTACGATCAGCTGGAATTCCAGGCCAATCCTAGTCTCGGCTTTCCGGCCAGCGATATAGATCGGGTGGAG
TTCTTCGAAGAGCGCGGCATGCTGCGGGCGCGGCTGCGCTTCAACCTGATGGGGTTGTTCGGTTCCAGTT
CGCCGCTGCCGGCGTTCTACAGCGAGCAGGCCCTGGGCGACAGTGAGGAGAGTAACCCTACGCGGAACTT
CCTCGATCTTTTCCATCACCGCCTGCATCGGTTGCTGTTGCCCATCTGGCGCAAGTATCGCTACCGGGTG
AGTTTCCAGAGCGGCGCGAGCGATGCGTTCTCCGCCCAATTGTTCTCCGTTGTCGGGCTGGGTGGAGAAG
AGATCCGCAAGGCCAGGGAGCTGAACTGGAAACGTCTGCTGCCCTACCTCGGTCTGCTCAGCCTGCGGGC
CCACTCGGCGGCCCTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCACGCCGAGCTGCTCGCCGAGCAA
TGCATCGAACGGCGCGTCGCGATCCTCGAGGAGCAGCGCAACCGGCTCGGTCTGTTCAACAGCCAGCTTG
GCGAGGACGCAGTGCTGGGCGAACGGGTTCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGATTGGCAGCGCTTTCACGAGTTCCTGCCAATCGGTCCCGGTTACCAGCCGCTTTGTGCGCTGGTGCGC
TTCACCCTGCGTGACCCGCTCGACTATGACATCCGACTGGTCCTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACCCGTGCCGCCTTGGCTGGACCAGTTGGCTGGGCCGGGAACGCGCCGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA