SecReT6
Protein ID: 152984945
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2902
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2986868..2987968 [+]
Producthypothetical protein
NoteTssA
UniProt IDA6V5C7
KEGG IDpap:PSPA7_2902
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.90E-23, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 8.90E-23, Aligned region: 213..229
ImpA-rel_N [PF06812], Evalue: 8.90E-23, Aligned region: 249..259
Protein Sequence: 366 a.a.     [Download]
>gi|152984945|ref|YP_001348262.1| hypothetical protein PSPA7_2902 [Pseudomonas aeruginosa PA7]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVERLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLQRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADATEG
DADGEESLPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|152983466|ref|NC_009656.1|:2986868-2987968 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAGGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCGGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGTTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGCTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTCGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTACAGCGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCATTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCTCCGCTGTCCGAAGAACAGCCCCCGGTCGCGGAGGCGGATGCCACCGAAGGC
GACGCGGACGGCGAGGAAAGCCTCCCGGCGAGCGCGCCGAGCGGGCCGGCCGGCGCGCCGACCAGTCGCG
AGGACGCCTACCGGCAACTGCTGCTGATCGCCGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAGTGGGGCAACAAGCCGCTGAGCGAGCTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGGGTCTGGTCGCTGCTTGGCGTGCTGCCCTAG