SecReT6
Protein ID: 152985112
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3610
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3736884..3739511 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA6V7C9
KEGG IDpap:PSPA7_3610
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.00E-43, Aligned region: 206..284
AAA_2 [PF07724], Evalue: 9.00E-43, Aligned region: 609..774
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 208..339
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 614..742
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 208..230
AAA_5 [PF07728], Evalue: 3.50E-13, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 1.00E-10, Aligned region: 784..860
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 610..707
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 15..94
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 186..230
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 584..648
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 2.10E-08, Aligned region: 770..840
AAA_17 [PF13207], Evalue: 5.50E-07, Aligned region: 208..276
AAA_17 [PF13207], Evalue: 5.50E-07, Aligned region: 445..454
AAA_17 [PF13207], Evalue: 5.50E-07, Aligned region: 612..648
AAA_19 [PF13245], Evalue: 6.80E-06, Aligned region: 205..233
AAA_19 [PF13245], Evalue: 6.80E-06, Aligned region: 353..384
AAA_19 [PF13245], Evalue: 6.80E-06, Aligned region: 609..635
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 208..235
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 613..649
Clp_N [PF02861], Evalue: 6.90E-05, Aligned region: 39..73
Clp_N [PF02861], Evalue: 6.90E-05, Aligned region: 102..122
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 202..227
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 613..631
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 473..495
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 607..642
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 201..225
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 609..638
AAA_14 [PF13173], Evalue: 0.00029, Aligned region: 208..345
AAA_14 [PF13173], Evalue: 0.00029, Aligned region: 612..695
AAA_18 [PF13238], Evalue: 0.00035, Aligned region: 208..231
AAA_18 [PF13238], Evalue: 0.00035, Aligned region: 614..643
Sigma54_activat [PF00158], Evalue: 0.00049, Aligned region: 203..225
Sigma54_activat [PF00158], Evalue: 0.00049, Aligned region: 612..710
TIP49 [PF06068], Evalue: 0.00091, Aligned region: 208..234
TIP49 [PF06068], Evalue: 0.00091, Aligned region: 256..288
TIP49 [PF06068], Evalue: 0.00091, Aligned region: 612..648
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 174..227
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 612..625
AAA_23 [PF13476], Evalue: 0.0021, Aligned region: 208..224
AAA_23 [PF13476], Evalue: 0.0021, Aligned region: 440..490
AAA_23 [PF13476], Evalue: 0.0021, Aligned region: 610..639
ResIII [PF04851], Evalue: 0.0042, Aligned region: 191..227
ResIII [PF04851], Evalue: 0.0042, Aligned region: 279..290
ResIII [PF04851], Evalue: 0.0042, Aligned region: 584..635
Zeta_toxin [PF06414], Evalue: 0.0066, Aligned region: 206..229
Zeta_toxin [PF06414], Evalue: 0.0066, Aligned region: 611..653
SRP54 [PF00448], Evalue: 0.0093, Aligned region: 208..229
SRP54 [PF00448], Evalue: 0.0093, Aligned region: 612..634
Protein Sequence: 875 a.a.     [Download]
>gi|152985112|ref|YP_001348964.1| type VI secretion ATPase [Pseudomonas aeruginosa PA7]
MINVDLQQLIQALDADTRRDLEGSAERCVARGGSRVLVEDLLLGLLERPQGLLARALQDAAVDAGELNAA
LQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLRNPLRYAGSRYQPLLARLDIE
RLKDFALSQPLEGAPSGKPGGGESLLQRFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLASRIAAGEVPPALRDVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAALRPTIL
FIDEAHTLIGAGGQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSVAE
AVTILRGLARVYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDILDTACARVRISLAAAPESLERL
RGELAEGERQRQALRRDAEAGLPIDHEALQVLEERLAQAESERHVLEDQWSRQRELAERLLALRQQLARA
REASREEQGGEADAEAFPADEHGGVEALEKALHETRQALADAQAQGRLVSFEVCPRLVAEVISAWTGVPV
EQLAREHNAKVVGFADDLRARIRGQEQAIRALDRSMRATASGLNKPDAPAGVFLLVGPSGVGKTETALAL
ADLLYGGERFITTINMSEFQEKHSVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEKADPDVLN
LFYQIFDRGVANDGEGHEIDFRNTLFLMTSNLASERIAALCRDGERPSPEILEDTIRPVLSQHFKPALLA
RMRVVPYYPVGGRVLRELIGIKLDRLGERLARRHLAFDYSSALVDHLGERCIQSDSGARLIDHLLDTHLL
PLVADRLLQAMARDERLVRVHATLDEHGHVFCEFA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3739511-3736884 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGATCAACGTAGACCTGCAACAACTGATTCAGGCGCTGGATGCCGACACCCGGCGCGACCTGGAGGGCT
CCGCCGAGCGCTGCGTCGCCCGCGGCGGCAGCAGGGTACTGGTGGAAGACCTGTTGCTGGGCCTGCTGGA
GCGTCCCCAGGGATTGCTGGCGCGCGCCCTGCAGGATGCCGCGGTGGACGCCGGCGAACTCAACGCCGCG
TTGCAAGCGCGCGGCGAGCACAGTGCCTCGCGCAATCCGGTGTTCGCGCCCGAGCTGGTGCAGTGGCTGC
AGGATGCGCTGTTGCTGGCCAACCTCGAACTGGGCCGTAGCCAGATCGACCAGGCGGCATTGATCCTGGC
CCTGCTACGCAACCCGTTGCGCTATGCCGGCAGCCGCTACCAGCCACTGCTGGCGCGGCTCGACATCGAG
CGGTTGAAGGATTTCGCGCTCTCGCAGCCGCTGGAGGGCGCGCCCAGCGGCAAGCCGGGTGGCGGCGAGT
CCCTGTTGCAGCGTTTCACCCACAACCTTACCCAGCAGGCGCGCGACGGCAAGCTCGATCCGGTGCTCTG
TCGCGACGGGGCTATTCGCCAGATGGTCGACATCCTGGCCCGTCGGCGGAAAAACAACCCCATCGTGGTC
GGCGAGGCTGGCGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCCTCGCGGATCGCCGCAGGGGAAGTGC
CGCCGGCACTGAGGGACGTCGAGCTGTTGTCCCTCGACATGGGCCTGTTGCAGGCCGGTGCCAGCGTGAA
GGGCGAGTTCGAGCGGCGCCTGAAAGGCGTCATCGACGAAGTGAAGGCAGCACTCAGGCCTACCATCCTG
TTCATCGACGAGGCCCATACGCTGATTGGCGCGGGCGGTCAGGCCGGCGGCTCGGATGCCGCCAACCTGC
TCAAGCCGGCCCTGGCACGCGGTGAGTTGCGTACCATCGCGGCGACGACCTGGGCCGAGTACAAGAAGTA
TTTCGAGAAGGACCCGGCGCTGGCCCGGCGTTTCCAGCCCGTGCAACTGCATGAGCCGAGCGTTGCCGAA
GCGGTGACAATCCTGCGTGGCCTGGCCCGTGTTTACGAGGAAAGCCACGGTATCTACCTGCGCGACGACG
CGGTGGTGGCCGCCGCCGAACTGTCCGCCCGCTACCTGGCGGGTCGCCAGTTGCCGGACAAGGCCGTCGA
CATCCTCGACACCGCCTGTGCGCGGGTGCGCATCAGCCTGGCGGCGGCGCCGGAGAGTCTCGAGCGCCTG
CGCGGCGAGCTGGCCGAAGGCGAGCGCCAGCGCCAGGCCCTGCGCCGCGATGCCGAGGCAGGGCTGCCGA
TCGACCACGAGGCCCTGCAGGTGCTGGAAGAACGCCTGGCCCAGGCGGAAAGCGAGCGGCACGTACTGGA
GGACCAGTGGAGCCGCCAGCGCGAACTCGCCGAGCGCCTGCTCGCCCTGCGCCAGCAATTGGCCAGGGCC
CGCGAGGCGAGCCGGGAAGAACAGGGCGGCGAGGCGGACGCGGAGGCTTTCCCGGCCGACGAGCATGGCG
GTGTCGAAGCCCTGGAAAAGGCCCTTCACGAAACCCGCCAGGCACTCGCCGATGCCCAGGCCCAGGGGCG
GCTGGTCAGTTTCGAGGTCTGCCCGCGCCTGGTCGCCGAGGTGATCAGCGCTTGGACCGGTGTACCGGTG
GAGCAACTGGCGCGGGAGCACAATGCCAAGGTGGTGGGGTTCGCCGACGACCTGCGGGCGCGAATCCGGG
GCCAGGAACAGGCGATCAGGGCACTGGACCGTTCGATGCGCGCCACCGCGTCAGGGCTGAACAAGCCCGA
TGCGCCGGCCGGTGTGTTCCTTCTGGTGGGGCCGAGCGGGGTGGGCAAGACCGAGACCGCGCTGGCGCTA
GCCGACCTGCTGTATGGCGGCGAGCGTTTCATCACCACCATCAACATGTCCGAATTTCAGGAGAAGCACT
CCGTCTCGCGCCTGATCGGTGCACCGCCCGGATATGTCGGCTATGGCGAGGGTGGCATGCTCACCGAGGC
GGTACGCCAGAAGCCCTATTCGGTGGTGTTGTTGGACGAAGTGGAGAAGGCCGATCCGGACGTGCTCAAC
CTCTTCTACCAGATATTCGACAGGGGTGTAGCCAACGATGGCGAAGGGCACGAGATCGATTTCCGCAACA
CCCTGTTCCTGATGACCTCCAACCTCGCCAGCGAACGTATCGCCGCGCTTTGCCGGGACGGCGAGCGGCC
GTCCCCCGAGATTCTCGAAGACACCATCCGCCCGGTGCTCAGCCAGCATTTCAAACCGGCGTTGCTGGCA
CGGATGCGGGTGGTGCCGTACTACCCGGTGGGCGGCAGGGTGCTGCGAGAGCTGATCGGGATCAAGCTGG
ACCGGCTCGGCGAGCGCCTGGCCCGCCGCCACCTGGCTTTCGACTACAGCTCTGCGCTGGTGGATCACCT
GGGTGAACGTTGCATCCAGAGCGACAGTGGCGCCCGGCTGATCGATCATCTGCTGGACACTCATCTTCTG
CCTCTGGTGGCCGACCGGTTGCTGCAGGCGATGGCGCGCGACGAGCGGCTCGTACGGGTTCACGCGACAC
TCGACGAGCACGGACACGTGTTCTGCGAGTTCGCCTGA