SecReT6
Protein ID: 152985292
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3607
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3733913..3735115 [-]
Producthypothetical protein
NoteFha
UniProt IDA6V7C6
KEGG IDpap:PSPA7_3607
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
Protein Sequence: 400 a.a.     [Download]
>gi|152985292|ref|YP_001348961.1| hypothetical protein PSPA7_3607 [Pseudomonas aeruginosa PA7]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDEFAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGTDAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPRPERDEAFWQRFGQA
LGVDLDGLDGLDGAAREALAINAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAG
EALGHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLAT
SGSRWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3735115-3733913 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACGGAGCTATGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACTT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAAATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGTTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTACAGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCGTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCC
CTCGGAGTGGACCTCGACGGCCTCGACGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCAACGCCG
CCGGTTTGCTGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGAACCCGCAGCGAACTGAAGAACGA
ACTGCGGCTGTCGCTGAGCACGTTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGC
GAGGCGCTGGGGCATCTGCTTCGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCA
GTTTCCGCGACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCT
CGAGCATTTCTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGCCGCCGGCCGTTGCTGGCTACC
TCGGGCAGCCGCTGGCGTGCCTACGGTCGCTACCACCAGTCGCTATGCCAGGACGACGACTGGAGCGAGC
GCCTGCTGGCGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGA
GCACCAAGGATGA