SecReT6
Protein ID: 152985461
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2892
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2975369..2977162 [-]
Producthypothetical protein
NoteTssF
UniProt IDA6V5B7
KEGG IDpap:PSPA7_2892
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.90E-182, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|152985461|ref|YP_001348252.1| hypothetical protein PSPA7_2892 [Pseudomonas aeruginosa PA7]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEATLLGGEEAQALTGVAAARSALRLSLRCMGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
TVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADRQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVPAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGPRALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c2977162-2975369 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTACGGCACGCCG
GCGGCGCCTTCGCCGAGCGCTATCCGAAGGTCGCCCGGCGCCTGCAACTGGCCCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGTCTGCTGGAAGGCTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCGGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAACCGGACCCGACCCAGGGCAACCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGCGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACCCTG
TGGCCGCTGGCGATCGACGAAGCGACCCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGCCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCATGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
ACCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCACTGTCCGGCGCGCTCGCCGACAGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACCTCTTTCCACGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
AAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTCGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTTGCCGGGAGCACCGTGCAGCCAGTCCCGGCCTACTATGGCTGCCGCCACGACAGCCACCTCG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGACCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTGCGCGAGGCCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCGCGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAGTCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTCTCGCTGGTGGAAGGCCCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTCGCCCTGCACAACCTGCGCGACGACGCCAGCGCCCGCCGGCAGATAGAAGGCCTGCGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
AATCCGCCTGCGACTCGATCCGCAGCACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGCTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA