SecReT6
Protein ID: 152985565
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3613
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3742501..3742908 [-]
Producthypothetical protein
NoteTssE
UniProt IDA6V7D2
KEGG IDpap:PSPA7_3613
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|152985565|ref|YP_001348967.1| hypothetical protein PSPA7_3613 [Pseudomonas aeruginosa PA7]
MTGYGSLFERLTGETDKRAGWSSEVSAMASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDALSQ
ARAAIESFIEAYEPRLGEVHVVPLPPDNDQLRLAFSIEGLLEVEGVKRQVSFSACLDGRGQVTVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3742908-3742501 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACCGGATACGGCAGTCTGTTCGAACGCCTCACCGGCGAGACGGATAAACGCGCTGGCTGGAGCAGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTACCCGATCTCAACGACATGCGCCTGAGCCTGCATGATGCCCTGAGCCAG
GCCCGGGCGGCCATCGAAAGCTTCATCGAGGCCTATGAACCACGCCTGGGCGAGGTGCATGTCGTTCCCC
TGCCGCCGGACAACGACCAACTCCGCCTGGCCTTCAGCATAGAGGGCCTGCTGGAAGTGGAGGGAGTCAA
GCGCCAGGTGAGTTTTTCCGCGTGCCTGGATGGGCGCGGCCAGGTGACGGTCAGTTGA