SecReT6
Protein ID: 152985590
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2888
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2968090..2970096 [-]
Producthypothetical protein
NoteTssI
UniProt IDA6V5B3
KEGG IDpap:PSPA7_2888
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-71, Aligned region: 53..324
Phage_base_V [PF04717], Evalue: 8.70E-22, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.70E-13, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.70E-13, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.70E-13, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.70E-13, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|152985590|ref|YP_001348248.1| hypothetical protein PSPA7_2888 [Pseudomonas aeruginosa PA7]
MPQHTDTTSSLSLTASALTELYPRAIAGQEALNDLANLLVLGFANTPLTLANAVITHITTTLHNDSQSRP
LDALIAEIHQLPADATADRYQLVLRPWLWWLTLASNNRVFQNLATSDIVTTIFKAHGFTDFKLSLTGSYE
PREYCVQYGETDFAFVSRLLEEEGIFWFFTHEEGKHTLVLADNNDAFPPIPNGPKVPYLGQEIGVRELHG
IRSAQYCLQAVAGTYSATDYEFTTPTTSLYSQAQAEAGPRAQYEHPGGYTAKARGDALTKQRVDGLRSQE
KRLIGESDCRWLVPGHWFTLTGHDDASLNIDWVLTSVTHEADHGHYRNRFEAIPKATAYRPPRTTLKPRM
HTQTAKVVGKAGEEIWTDQYGRIKLQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKETRTVTVGADQTHSTGG
NYSHQVSGDFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLVAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGAEQTVDGGGMLTLKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c2970096-2968090 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCCCCAGCACACCGACACCACTTCCAGCCTTTCCTTGACGGCGTCGGCGCTCACGGAACTCTATCCGC
GGGCCATTGCTGGACAGGAGGCGCTGAACGATCTCGCAAATCTGCTAGTCCTGGGCTTTGCCAACACTCC
GCTCACCTTGGCTAACGCCGTAATCACCCACATCACCACCACCCTCCACAACGACTCACAGTCCCGCCCG
CTCGACGCCCTCATCGCCGAAATCCACCAACTGCCCGCCGACGCTACCGCCGACCGCTATCAACTCGTCC
TCCGCCCCTGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGCGTATTCCAGAATCTCGCCACCAGCGA
CATCGTCACCACGATCTTCAAGGCCCACGGCTTCACCGACTTCAAGCTGTCGCTGACCGGCAGCTACGAG
CCCCGTGAATACTGCGTGCAGTACGGCGAGACCGACTTCGCCTTCGTCTCGCGCCTGCTGGAGGAGGAAG
GCATCTTCTGGTTCTTCACCCACGAAGAGGGCAAGCACACGCTGGTGCTGGCGGACAACAACGATGCCTT
CCCGCCCATCCCCAACGGGCCCAAGGTGCCGTACCTGGGCCAGGAAATCGGCGTGCGCGAGTTGCACGGC
ATCCGTTCGGCGCAGTACTGCCTGCAGGCGGTGGCCGGGACCTACAGTGCCACCGACTACGAGTTCACCA
CGCCCACCACTTCGCTCTATTCCCAGGCCCAGGCGGAAGCAGGGCCACGCGCGCAATACGAACACCCCGG
GGGCTATACCGCCAAGGCGCGGGGCGATGCGCTGACCAAGCAGCGCGTGGACGGCCTGCGCAGCCAGGAG
AAGCGGCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCGGGGCACTGGTTCACCCTGACCGGACATG
ACGACGCCAGCCTGAACATCGACTGGGTGCTGACCTCGGTGACCCACGAGGCCGACCACGGGCACTACCG
CAACCGCTTCGAGGCCATCCCCAAGGCCACCGCCTACCGCCCTCCCCGCACCACGCTCAAGCCACGCATG
CACACTCAGACCGCCAAAGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGCTCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCGTCGTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCACGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTATG
CGCTGCCGGACAACCAGACGCAATCCGGCATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGTTTCGAGGACAAGAAGGACGCCGAGGAGGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAAACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAG
CGACAGCCTGGATGTGAAGGAAACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACCAGGTCAGCGGCGACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAAAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGTCGCCCAGGCCGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCGCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCCTCAAGGGCGGCCTGGTAAAGGTCAACTGA