SecReT6
Protein ID: 152985666
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2899
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2980991..2982283 [+]
Producthypothetical protein
NoteTssK
UniProt IDA6V5C4
KEGG IDpap:PSPA7_2899
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-68, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|152985666|ref|YP_001348259.1| hypothetical protein PSPA7_2899 [Pseudomonas aeruginosa PA7]
MQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPVFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLARQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVSGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|152983466|ref|NC_009656.1|:2980991-2982283 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGAGTGACCGCCCTGGAACTGGACCCCTCGGCGTTGTGCGCCGGCCA
AGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCGCCGCTGGAGTTCGATCTGGAGACAGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGTGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ACGTCAGCCTGCCCTATGTCCCGCCGACGCCACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCA
GTCGCTCTGCGCACGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGCAACCAGGACGACGCGGTGGAAATCCGTCGCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCG
AAGGCCTGCTGGCAAGCCGCGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGCGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGTCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGCTGGAGCGGGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTATTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGCCAGCGCCTGGTGGT
CGGCCTGCGGATGCCCGCCGGCGCCGGCGAACAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGACCCGCACCTGCCGTTGCTCGCCCGGCAACGCATGAGCGGGCTGGCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTCGGCGACGACACCCGTTTGTTCGTCGTGCAGGGCGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCAGCGGGGTTGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAG