SecReT6
Protein ID: 152985887
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3616
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3744965..3746521 [-]
Producthypothetical protein
NoteTssA
UniProt IDA6V7D5
KEGG IDpap:PSPA7_3616
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 55..115
ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 236..251
Protein Sequence: 518 a.a.     [Download]
>gi|152985887|ref|YP_001348970.1| hypothetical protein PSPA7_3616 [Pseudomonas aeruginosa PA7]
MTYSSKLSLHYLELADQPISKDVFAGEDVRFSSEYEALENELGKALSLHESGQVDWLKILENSEVLLRTQ
SKDLRVAAWLTWALYQRESFSGLLAGLGLLDRLCCRHWVEMHPAKPRTRAAAIAWLVPRLEQALSESVPL
KEQFPLFRRLVEHLDSLDSVLTEQLGDEAPLLLPISRRLAGMLQRTTDVQPEPGMVGAMVAQVKQAASQL
LAPGTPIDNERDAHKSMRAQQEAARSLCAWWLRQKATDLRALRLNRTMLWLPIETMPERNGEQVTALRGV
PADRLKSYQERFAQGLYADLLVELEASLSRAPFWFDGQRLVWECLQGLNADKAMREVEMHFALLLQRLPG
LVDLRFHDGTAFAEPATRSWISAHVMPHLQSGSVPRMAENVALQAEWDIALDEAQPILRKDGLKAAVKVL
KQGMTRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDQQLHESGLSAWEPELALDVLHLLHSCCEL
LPQNHAVRERKDDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3746521-3744965 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACCTATTCAAGCAAGCTCTCCTTGCATTATCTCGAACTCGCGGACCAGCCGATTTCAAAGGATGTCT
TTGCGGGGGAAGATGTGCGTTTCTCCAGTGAGTACGAAGCCCTGGAGAACGAGCTGGGCAAGGCGCTGTC
GCTCCACGAAAGTGGTCAAGTCGACTGGTTGAAGATCCTGGAAAACAGCGAGGTGCTTCTGCGCACCCAG
TCCAAGGACCTGCGTGTCGCCGCTTGGTTGACCTGGGCTCTCTACCAGCGCGAGTCCTTTAGCGGGTTGC
TGGCCGGCCTGGGACTGCTGGACCGGTTGTGCTGCAGGCACTGGGTCGAGATGCACCCGGCCAAGCCGCG
CACCCGAGCCGCGGCCATCGCCTGGCTGGTGCCTCGATTGGAGCAGGCGCTCAGCGAGAGCGTTCCGCTC
AAGGAGCAATTCCCCCTATTCCGACGTCTCGTCGAGCATCTGGACAGCCTCGATTCCGTCTTGACCGAGC
AGTTGGGCGATGAAGCACCGTTGCTCCTGCCTATCAGCCGGCGCCTGGCGGGCATGCTCCAGCGCACCAC
TGACGTCCAGCCGGAGCCCGGGATGGTCGGCGCCATGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCTCCCGGTACCCCCATCGACAACGAGCGTGACGCGCACAAGTCCATGCGCGCCCAGCAGGAAGCCG
CTCGTTCCCTGTGCGCCTGGTGGCTGCGGCAGAAAGCCACCGACCTGCGCGCGCTGCGCCTCAACCGGAC
GATGCTCTGGCTGCCCATCGAGACCATGCCAGAGCGCAATGGCGAACAGGTCACCGCGCTCAGGGGCGTA
CCGGCGGACAGGCTGAAGAGCTACCAGGAGCGTTTCGCCCAAGGCCTGTACGCCGACCTGCTGGTGGAGT
TGGAAGCGAGCCTGTCCCGGGCGCCGTTCTGGTTCGACGGGCAGCGTTTGGTCTGGGAATGTCTGCAGGG
GCTCAATGCCGATAAGGCTATGCGGGAAGTCGAGATGCATTTTGCGCTGCTGCTGCAGCGGTTGCCGGGT
TTGGTGGACCTGCGCTTCCACGATGGCACGGCGTTTGCCGAACCGGCCACCCGCAGCTGGATCAGTGCCC
ACGTCATGCCGCATCTACAGAGTGGCAGCGTCCCGCGCATGGCGGAGAACGTGGCGCTACAGGCCGAGTG
GGACATTGCACTCGACGAGGCCCAGCCAATCCTGCGCAAGGACGGCTTGAAAGCCGCAGTAAAGGTCCTC
AAACAGGGCATGACGCGTGCACATGGCGGTCGCGCCCGGTTCTTCTGGCAACTGAGCCTGGCACGGTTGT
GCTTCCTGGCGAAGAAATACGAACTGGCCAAGACCCAACTGGAAAGCCTCGACCAGCAGTTGCACGAGTC
CGGCCTCAGCGCCTGGGAACCCGAGCTTGCGCTGGATGTACTGCACCTGCTGCACAGTTGCTGCGAGCTG
CTGCCGCAGAACCATGCCGTGCGAGAACGCAAGGACGACATTTATCGCAGGCTGTGCCATCTCGATCTCG
AGGTGGTGCTCGAATAG