SecReT6
Protein ID: 152986312
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2900
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2982301..2983059 [+]
Producthypothetical protein
NoteTssL
UniProt IDA6V5C5
KEGG IDpap:PSPA7_2900
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|152986312|ref|YP_001348260.1| hypothetical protein PSPA7_2900 [Pseudomonas aeruginosa PA7]
MPEGSAGPFSQAYLEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADPEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|152983466|ref|NC_009656.1|:2982301-2983059 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCTGGAGCAGCCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGCGACGCCCAGGATGTGCCACGGATGGT
CGAACGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGTCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGCTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTCGAGCAGCCTGCCGCTGCGCCGCCACGACGCCTGCCGGTGCGCGCGGCGCTGCCGGACGGC
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGCTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCACGAAATGGCGGCGGTGACTCACCTGGCCGATCCGGAGCAGGCGCCATGA