SecReT6
Protein ID: 152987994
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3614
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3742921..3744396 [-]
Producthypothetical protein
NoteTssC
UniProt IDA6V7D3
KEGG IDpap:PSPA7_3614
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-190, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|152987994|ref|YP_001348968.1| hypothetical protein PSPA7_3614 [Pseudomonas aeruginosa PA7]
MSTNAAQQNRNENGEYNILDSIIAETRLSPDDEAYDIARRGVSAFIEELLKPQNEGEPVKKAMVDRMIAE
IDAKLGSQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIRIEILSVSKEDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYLSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTRLTDSFAKYRWCPNIVGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREFELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3744396-3742921 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAGCACGAATGCTGCACAGCAAAACCGGAACGAGAACGGTGAGTACAACATTCTCGACAGCATCATTG
CCGAAACTCGCTTGAGCCCGGACGACGAGGCCTACGACATTGCCAGGCGTGGTGTGTCGGCCTTCATTGA
GGAACTGCTCAAGCCGCAGAACGAAGGCGAGCCGGTGAAGAAGGCGATGGTAGATCGGATGATCGCCGAG
ATCGATGCCAAGCTCGGCAGTCAGATGGACGAGATCCTCCATCATCCGGACTTCCAGGCCCTGGAGTCGG
CCTGGCGCGGCCTGCAATTGCTGGTCGACCGCACGAACTTCCGCGAGAACATCAGGATCGAGATCCTCAG
CGTATCCAAGGAGGACTTGCTGGACGATTTCGAGGACTCGCCGGAGGTAATGCAATCCGGCCTGTACAAG
CATATCTATACCGCAGAATATGGACAGTTCGGTGGCCAGCCGGTCGGCGCGATCATCGCCAACTACTACC
TGTCGCCCAGCTCGCCGGACGTCAAGCTGATGCAGTACGTCTCCAGCGTGGCCTGCATGGCCCACGCGCC
GTTCGTGGCCGCTGCCGGGCCAAAGTTTTTCGGCCTGGAGAGCTTTACCGGGCTGCCGGACCTGAAGGAC
CTGAAGGATCACTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCTCGCT
ATGTGGCGCTGACCGTCCCGCGATTCCTGCTGCGCACGCCTTACGATCCGGAAGAAAACCCGGTCAAATC
GTTCGCCTACAAGGAGACCGTGGCCAACAGCCACGAGCACTACCTGTGGGGCAACACCGCCTATGCCTTT
GGTACCAGGCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAACATCGTCGGGCCGCAGAGCGGCG
GCGCGGTGGAGGACTTGCCGCTGCATCACTTCGAAAGCATGGGCGAGATCGAGACCAAGATTCCTACCGA
GGTGCTGGTGTCCGATCGCCGCGAATTCGAGTTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGTAGCGATAACGCAGCGTTCTTTTCCGCCAGTTCGGTGCAGAAGCCGAAGTTCTTCGGTATCAGTGCCG
AAGGCAAGGCTGCGGAGCTGAACTACAAGCTCGGTACCCAACTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTGCTGCAACGCGAGCAACTGGGCTCTTGGAAGGAACGCACCGACCTGGAACTG
GAACTGAACAAGTGGATCCGCCAGTACGTTGCCGACCAGGAAAACCCCAGCGCCGAGGTCCGCGGCCGGC
GTCCTCTGCGTGCCGCGCAGATCATCGTCAGTGATGTCGAGGGTGAGCCGGGCTGGTACCGCGTCAGCTT
GAACGTGCGTCCGCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGTTGGTCGGCAAGTTGGACAAG
GAGTAA