SecReT6
Protein ID: 152988298
SecReT6 ID218
T6SS typei4a
Gene symbol-
Locus tagPSPA7_2893
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]2977146..2977571 [-]
Producthypothetical protein
NoteTssE
UniProt IDA6V5B8
KEGG IDpap:PSPA7_2893
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|152988298|ref|YP_001348253.1| hypothetical protein PSPA7_2893 [Pseudomonas aeruginosa PA7]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRVAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c2977571-2977146 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAATACACGGCGTCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTATGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGTGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA