SecReT6
Protein ID: 152988603
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3615
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3744423..3744929 [-]
Producthypothetical protein
NoteTssB
UniProt IDA6V7D4
KEGG IDpap:PSPA7_3615
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-52, Aligned region: 6..159
Protein Sequence: 168 a.a.     [Download]
>gi|152988603|ref|YP_001348969.1| hypothetical protein PSPA7_3615 [Pseudomonas aeruginosa PA7]
MAKEGSVGPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVENRKPISIDKMTFDEVLAKQE
LGLTLSVANRLQVEGGCEELAVSLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IEGVLADDESRSRVLGELGLNTTPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3744929-3744423 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGGCCCAAAGGAACGCATCAACGTCACTTTCAAACCCGCCACGGGCGGGG
CGCAGGAGGAAATCGAACTGCCGTTGAAGCTGCTGGCGATCGGGGATTACACCCAGCGCGCGGATGAGCG
CAAGGTGGAGAATCGCAAGCCCATCAGCATTGACAAGATGACCTTCGACGAAGTGCTGGCCAAGCAGGAA
CTGGGCCTGACCCTGAGCGTGGCCAACCGTCTGCAGGTGGAGGGGGGCTGTGAGGAGTTGGCGGTTAGCC
TGCAGATCAACTCGATGAAGGACTTCAATCCCGCCAGCATCGTCGAGCAGGTGCCCGAGTTGAAGAAACT
GATGGAACTGCGCGATGCGCTGGTCGCCCTCAAGGGGCCGCTGGGTAATGCCCCGGCGTTCCGCAAGGCC
ATCGAAGGCGTGCTGGCAGATGACGAATCCCGTAGCCGTGTGCTGGGCGAGTTGGGACTGAATACCACAC
CATCCCAGGACGCCTGA