SecReT6
Protein ID: 152988907
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3612
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3740495..3742282 [-]
Producthypothetical protein
NoteTssF
UniProt IDA6V7D1
KEGG IDpap:PSPA7_3612
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.40E-187, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|152988907|ref|YP_001348966.1| hypothetical protein PSPA7_3612 [Pseudomonas aeruginosa PA7]
MPFNHYYQSELTALRQLGRRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGEALRVERDTPVESRPVGEVACRFRTCYTTEVLPLTLKALNYSV
TGDGALLGLRLEMNCDGHLGELRLNRLRLHLTGERYISQMLYLCLLRNLDNIQLIPLGAQGLPLDGVDGK
PLAFRLAGERVRPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLELLDSLPDDLLKQVRG
LDLRFDIRKNGIQRLHPTLENIRLYCTPVVNLFRHDALPIRLDGKQDEYLLMPVRYALEDCGVFSVESVT
GWRPGGLGYRGYVPFESFEHDPSFDVPEARPHYSIRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLHRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3742282-3740495 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCCCTTTAACCACTACTACCAGAGCGAACTCACCGCACTGCGACAGTTGGGACGCCGTTTCGCCGAGC
GCAGCCCAGCCTTGGCGCCGTTCCTCGGTCAGGCCGGGCGCGATCCGGACGTCGAGCGGCTGCTCGAGGG
CTTCGCCTTCCTGACCGGACGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACTTGCTGTGGCCGAACTATATGCGCCCCTTGCCGGCGTTCAGCATCCTCCAGTTCGACCCGCTGA
CCCGACCAGGCGAAGCACTGCGCGTGGAACGCGATACCCCGGTGGAAAGCCGGCCGGTAGGCGAGGTCGC
CTGCCGCTTCCGCACTTGCTATACCACCGAAGTCCTGCCGCTCACCCTGAAGGCGCTGAACTACTCGGTG
ACTGGCGACGGCGCATTGCTGGGCTTGCGACTGGAGATGAACTGCGACGGGCATCTCGGCGAGCTGCGAC
TGAATCGTCTGCGCCTGCACCTGACTGGCGAGCGTTACATCAGCCAGATGCTCTACCTGTGCCTATTGCG
CAATCTGGACAATATCCAACTGATCCCGTTAGGCGCCCAGGGGCTTCCGCTCGATGGGGTCGACGGCAAG
CCGCTGGCGTTTCGCCTGGCGGGCGAGCGGGTGCGGCCGGTGGGGTTCGCCGAGGACGAGGCGCTGATTC
CCTATCCGCTGAATACCTTCCGCGGCTACCGCTACCTGCAGGAGTACTTTGCGTTCCAGGACAAGTTCCT
TTTCGTCGACGTCGATGGACTGGAGCTGCTCGACAGCCTGCCCGATGACCTCCTCAAGCAGGTTCGTGGC
CTGGATTTGCGTTTCGATATCCGCAAGAACGGCATCCAGCGCCTGCACCCGACGCTGGAGAATATCAGGC
TGTACTGCACTCCGGTGGTCAACCTGTTCCGCCATGATGCGCTACCTATCCGTCTCGACGGCAAGCAGGA
CGAGTACCTGCTTATGCCGGTCAGATACGCCCTGGAGGACTGCGGAGTGTTCTCGGTGGAAAGTGTCACC
GGCTGGCGGCCGGGCGGACTAGGCTACCGGGGATATGTGCCGTTCGAATCGTTCGAGCACGATCCCAGCT
TCGATGTACCCGAGGCTCGTCCCCATTACAGCATCCGGCAACGCACCTCGCTCCTGCATGATGGCCTGGA
TACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACACTGTCGGTGGAGCTTACCTGCACG
AATCAGAACCTGCCGCAGCGGCTGCGCCTGGGCGACATCTGCGTCGCCTGCGAAGGCACACCGGAGTTCC
TCGGTTTCCGCAATATCACCCCGGCGACCCCGAGTTACGCGCCGCCGTTGCACCGCGACTTCCTCTGGAA
GCTGATCAGCAACATGTCGCTCAACTACCTGTCTTTGGCCAACGTCGATGCACTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCCGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCTTGCACCGAGGGCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTATATCGGCGAGGGCGACCTGTTTGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCACTTTACGCCAGCATCAACTCTTACCACGAATTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA