SecReT6
Protein ID: 152989564
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3606
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3733401..3733907 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA6V7C5
KEGG IDpap:PSPA7_3606
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|152989564|ref|YP_001348960.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEQGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLDQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3733907-3733401 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGTT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAGCACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGTTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGCAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGACCAGAAGGGCATCCTGAATGCCGGCGAACTGCTCGGCAAGG
CGGGTGACGCGCGATGA