SecReT6
Protein ID: 153946881
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0729
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]891097..891783 [+]
Producthypothetical protein
NoteTssL
UniProt IDA7FEP0
KEGG IDypi:YpsIP31758_0729
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.80E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|153946881|ref|YP_001399718.1| hypothetical protein YpsIP31758_0729 [Yersinia pseudotuberculosis IP 31758]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDSAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLTTLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|153946813|ref|NC_009708.1|:891097-891783 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAACAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCGCTGCTGGATGAAACTGTGAAAGGGCGCGGTGTACAGGATGACGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGGAGCCAGTTGTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGACAGCGCAGTGCTGACCTGTTTTCACCGGGTATTGATG
TTGGGTTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGCTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTATCCGGTCTGTTAACCACCTTACTGCCGGAGCCGGTGTAA