SecReT6
Protein ID: 153946938
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0780
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]936427..937113 [+]
Producthypothetical protein
NoteTssL
UniProt IDA7FET7
KEGG IDypi:YpsIP31758_0780
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|153946938|ref|YP_001399765.1| hypothetical protein YpsIP31758_0780 [Yersinia pseudotuberculosis IP 31758]
MNHQITEHSPTGNIDALLQDTWLQVISLRQGMACSEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGNQLYERMRTVLREPAPDSAVLTCFHRVLM
LGFLGGYRSVAVPEREQLVSQLTARVPAFSFLPSRGILATASSRNRLGVWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLLTLLPGPM
 
Nucleotide Sequence: 687 bp     [Download]
>gi|153946813|ref|NC_009708.1|:936427-937113 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAACCATCAAATAACTGAACACTCCCCTACGGGGAATATTGATGCATTACTACAGGATACCTGGCTGC
AGGTGATCAGCCTGCGTCAGGGAATGGCCTGCTCCGAAGGCGAAGGGCAGGCATTTTGGCAACGCTGTGT
GGCAGACATTGAACGTGTCCATCAGGCGCTGAAAGATGCCGGCCACAGCGAACAGAGTTGCCAGCACATC
AGGTACGCACAATGTGCTCTGCTGGATGAAACTGTGAAAGGCCGCGGTGTACAGGATGATGCCTACTTTG
TATGGTGTCACTCGCCCTTGCAGGCGCATTTTTTCAACACTCTAGATGCCGGTAACCAACTTTATGAGCG
GATGCGCACCGTGTTGCGTGAGCCCGCACCCGATAGTGCAGTACTGACCTGTTTTCACCGGGTGTTGATG
TTGGGGTTCCTCGGGGGATATCGCTCTGTTGCGGTACCTGAACGAGAACAACTGGTTAGCCAACTGACGG
CACGGGTGCCGGCGTTCAGCTTTTTACCATCACGAGGGATCTTGGCAACAGCCTCATCCCGTAACCGTCT
TGGGGTCTGGCTGCGTTACTGGCCAGTGCGACTGGGGTTGGCTGCGCTGATGGTCGCGCTGCTGTGGTGG
GGTCTTGACCACTGGCTATCTGGTTTGTTACTGACATTGTTACCGGGGCCAATGTGA