SecReT6
Protein ID: 153946939
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0730
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]891783..893519 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDA7FEP1, A7FEP1
KEGG IDypi:YpsIP31758_0730
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.50E-15, Aligned region: 447..543
Protein Sequence: 578 a.a.     [Download]
>gi|153946939|ref|YP_001399719.1| OmpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSDPLFAGLATEN
GLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVN
PQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGS
LADWQRAESRAVQAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVDPLAPQQIIQQQVASLADPVPASLW
QHWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAW
QNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDA
QANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQVPD
VKTASQDESDVSTQEMEK
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|153946813|ref|NC_009708.1|:891783-893519 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGTCGGTGGTGGCAACGTGGGTTGTGGCTCTGGGCGGGTTTGCTGGCGGTCATCTTGTGTCTGGCAT
TTCTGCCGCTCTCCCCGTGGGGGCGCTGGCTGATGCTGGCATGGGTGGTGCTGATTTGCATGTTGGGCGG
GTCGCGGGCAGGGCGGCAAGCGGCCGGTGCATCCTCTGATCCGCTGTTCGCCGGGTTGGCAACTGAAAAC
GGTCTTCTGCCTGAAAACAGTCGCTTACCGGTGGTGTTGGTGTGTGGTGATGGTCTGGCGTCATGGTTTG
GTCGCGAACGGTCACACCAGAGTGCACAGGGCTGCTGGCTGCGGGTGGATGATATCAGCACCCTGCGGCA
GTTTGCCCGACAACTGCTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTCGTGAAC
CCGCAGCAACGCCGCGATGAGCGCCTGCTGGCCGCCGATCTGCAAGAGCTGCGCTGGCAACTGATGCAAC
TGCGCCGCGATAGCCGCCATCCTGTTCCCTTGCTCCTGAGCAGCACGGTGGCCACCTCGGTTGCCCGTGA
TACGGTCTGGCTGTCACAGCAGCAGACACCGCCGCTGACACTCTGGTCAACCGTCTCGACGCCGGGCTCT
CTGGCCGACTGGCAGCGTGCGGAAAGCCGTGCCGTACAGGCTGAACGACTGAAACAGGCGGTGCTGTTCA
GCAGCCAGCATGACTGGCTGAACGCACAGGTGCTGCCGGTATTGCAGGCACCCAATGCGGATGTTGACCC
CCTTGCCCCGCAACAGATTATTCAACAGCAGGTTGCCAGTCTGGCCGATCCGGTGCCTGCCTCGCTGTGG
CAGCACTGGCTGGCGGCGCATACCACGCTGACACAGGTGGCGGGTTGGCATCCACCGCCGCCCGCCGCCC
ATGACGCCTTACCGCTGCCGGATTTTGTCTTTTCAGCGCTTCCTCTTGGTAGCGGGGTGTCGTCACGCCG
TCGGGTACTGCGCCATGGTGTCACCTTACTGACGTTGGCGGCGATGGTGGCGTTGTGCAGCAGCGCCTGG
CAGAACCGGCAACTGTTGCACCGGGTGGCCTTTGATATCCGTCAGTACCACAGCGTGGCGATGACGGATT
ATTCCCCGAAAGCGCAGGCGGTGGCGGTATTACGCCGTGATGCGGGGCTGCTTGATGAAGGGTACCGCAA
CGGTGAACCGCTGCGTCTGGGCCTGGGGTTATATCGGGGGGAGCGGCTGCGCCCGCCGCTGTTGGCGGCG
ATCAAAAGCTACATCCCGCCCCCTCCGCCCCCTCCCGCGCCACCGGCGCCGAAAACCGTGCGCCTCGACA
GCCTGTCACTGTTCGATGTGGGTAAATTCACGCTGAATGCGGGGTCCACCAAAATGCTGGTCACGGCGCT
GATCGACATCAAAGCCAAACCCGGCTGGCTGATCGTGGTGGCCGGGCATACCGACATCACCGGCGATGCG
CAGGCCAACCACATTCTGTCGCTTAAGCGCGCCGAAGCATTACGCGACTGGATGCTGTCAACCAGCGACG
TCTCGCCGACCTGCTTTGCGGTGCAAGGTTACGGGGCCACACGCCCTATCGCCGACAACGATACTCCCGA
CGGTCGGGCGCTCAACCGCCGGGTCGAAATCAGTCTGGTACCACAGGCTGATGCCTGTCAGGTGCCGGAT
GTAAAAACAGCGTCACAGGATGAAAGTGACGTATCAACGCAAGAAATGGAGAAGTAA