SecReT6
Protein ID: 153947187
SecReT6 ID224
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_2492
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]2815051..2816652 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7FJN3
KEGG IDypi:YpsIP31758_2492
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 354..364
Protein Sequence: 533 a.a.     [Download]
>gi|153947187|ref|YP_001401461.1| ImpA domain-containing protein [Yersinia pseudotuberculosis IP 31758]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRATSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQGLSLWDEGVRPQLGGLYTALENRLVQSGGLNAVVPQNSSGS
SSAGSLNPANTASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWEPGLVFEVKAR
RLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c2816652-2815051 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCTGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTGCAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGTTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGGGGCTCAGTCTCTGGGACGAAGGTGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGTGCAATCTGGTGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCAGCCAACACGGCGTCACCGGCGTTGCGGCCAGTGCAATCGGGACGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACACCAGTCACCGCCGTTGGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAACTCAAGCGCCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
CCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGCAGTCACGACCGGGGATCACCACGGCGCGCCATCAGTGGCTGCTGC
GTCTGGTGATGGCCCGGGTGGCGGAGCAGTACGGTAAGAACGATATGGCCTTGCATCTGCTGAGTGGCCT
TGATAGCAGCGGCGCGTTGTTGACCTTGCCACAGTGGGAGCCGGGGTTGGTGTTTGAAGTTAAAGCCCGC
CGTTTGAAGCTGTTGCGTATGAAGGCACAGCGGGGTGACAGTGATAAAACCCGCCTGCATGCTGAAATGG
AAAGCCTGCTCAGTGGGCTTATCGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA