SecReT6
Protein ID: 153947194
SecReT6 ID220
T6SS typei1
Gene symbol-
Locus tagYpsIP31758_0316
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]365436..367256 [+]
Producthypothetical protein
NoteTssF
UniProt IDA7FDI2
KEGG IDypi:YpsIP31758_0316
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-200, Aligned region: 3..606
Protein Sequence: 606 a.a.     [Download]
>gi|153947194|ref|YP_001399310.1| hypothetical protein YpsIP31758_0316 [Yersinia pseudotuberculosis IP 31758]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSVHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPDVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGAPKGRGRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLL
DKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGEL
YLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|153946813|ref|NC_009708.1|:365436-367256 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTGTTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAACTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACGCAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAGCGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAGTATTTTTGCTTCCCTGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCGGACGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
CCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGCTCCTAAGGGGCGCGGCCGGGGGCATGGCAGGGTGTACACCTCGTTTGAGAGCT
TCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATT
ATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAA
GAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCA
ATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTA
TCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTG
GATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCTGCCA
GGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGG
CTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGGGCCTTTAGCTCTGAAGGCGAGCTT
TATCTCTTCAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAA
AAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTA
A