SecReT6
Protein ID: 153947279
SecReT6 ID221
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0733
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]896953..899301 [+]
Producttype VI secretion system family protein
NoteTssI
UniProt IDA7FEP4
KEGG IDypi:YpsIP31758_0733
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 3.20E-48, Aligned region: 610..751
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 589..619
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|153947279|ref|YP_001399722.1| type VI secretion system family protein [Yersinia pseudotuberculosis IP 31758]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFENGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAERGIFISAD
GQAKAQGQVLEMQPAIGLLQGAQEQMEAISADAQTATASPADLQAQISLLQQNLNELKQAVVLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADISVGKNFFIGVGNTLSVFVRKLGIKLIANQGAITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAP
ETTEPTSHFTFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|153946813|ref|NC_009708.1|:896953-899301 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGTTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCCACCATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGAGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCGACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCTGGCACCTTGCCCGCACGGGTCACCAGCACCAC
CGCGAATGACACCTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTCGACCGGGAC
AGTTGGGAGCCGGGTTACGAGAGCCTGTGGGTCCGTCAGGCCCGGCCATATGCGGGTGACACCTACGGCC
TGCACCTGCCGCTGCTGGCCGGTACCGAAGTGGCGATTGCATTTGAAAACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCATTGCGGGCAGAAAGGGGCATTTTTATCAGTGCCGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATTGGCCTGTTGCAAGGTGCTCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTACAGCAAAATCTGAACGAGCTGAAACAGGCGGTGGTATTGCTGAGTGCGCCCAAAGGCATC
GCCCTGAGCAGTGGTGAGCATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATATCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGAGCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATAACGC
TAAATGCAGGCGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAGGCAAATAAACCAGAAGATTTTCCGAGTGTTGCCCCG
GAAACAACAGAACCCACCAGTCATTTCACTTTTTCCTGA