SecReT6
Protein ID: 153947539
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0785
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]942531..945029 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA7FEU1
KEGG IDypi:YpsIP31758_0785
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-67, Aligned region: 34..354
DUF2345 [PF10106], Evalue: 6.90E-49, Aligned region: 610..751
T6SS_Vgr [PF13296], Evalue: 6.10E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 6.10E-35, Aligned region: 589..618
T6SS_Vgr [PF13296], Evalue: 6.10E-35, Aligned region: 629..650
Phage_base_V [PF04717], Evalue: 1.40E-15, Aligned region: 390..481
Protein Sequence: 832 a.a.     [Download]
>gi|153947539|ref|YP_001399769.1| Rhs element Vgr protein [Yersinia pseudotuberculosis IP 31758]
MNTSLPAIRFDHSHHKLVVRDSTAPVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLAEVGLWFRFTADPKLNIDVVEFYDDQRFYPP
GLTLQAVPPSGMHDSGVESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLIAGSEEREPESESGAFYARLRHERYLNNQARFSGVANAATLGPGQELKVTGSDVPAQFGKGVIITRI
TSYARRDRSYEVHFEAIPYSEEYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGLFISAD
GQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASPADLQAQISLLQQNLSELKQAVVLLSAPKGI
ALSSGEHLQMSASENLIATAGKNTDISVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKAKQVVAMPEFQL
IPGGKHNLQFLFTDDDNVPYSNTPYIAYLVDGREIKGVTDAKGNTEKFVTDEEQNIKINLQV
 
Nucleotide Sequence: 2499 bp     [Download]
>gi|153946813|ref|NC_009708.1|:942531-945029 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATACCTCTCTCCCTGCTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACGG
CTCCCGTCGATGTGCTGGGTTTTGAAGGCCACGAAAGCTTAAGTCAGCCGTTCTGTTACGACATTCAATT
TACCAGCGCAGACAAGGCGATTGACCCGGCCACGATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCCTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGCGTGGTGACCGGAT
TTAAACGCCTGTCTGCTTCAAAAGATGAATGCCGTTACGAACTGAGCCTGCAACCGCGTTTGGCTTTGTT
GTCGCGTAGCCATCAGAACGGGATTTATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCCCGCCGTGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCAGCCGCCTGCTGGCGGAAGTGGGGCTCTGGTTTCG
TTTTACCGCTGACCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAACGTTTTTACCCGCCA
GGGCTGACGCTACAAGCGGTGCCACCTTCGGGGATGCACGACAGCGGCGTGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGATCGCAGGCAGCGAAGAGCGTGAGCCGGAAAGTGAAAGTGGGGCGTTTTATGCCCGCCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGTTTTTCGGGGGTGGCCAATGCGGCGACACTGGGGCCGGG
TCAGGAGCTGAAAGTCACCGGAAGCGATGTGCCGGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCTATGCCCGCCGTGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGTCCAGCGCTTATCCGTAAGCCGACCATGGCCGGAACCTTGCCGGCGCGGGTGACCAGCACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGCCGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCGCTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAAGATGGCAATCCGGACCGGCCGTA
TATTGCCTCTGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGTAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTTGAAGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAACCACGGGGTGA
AGGTTTTGAGCTGCGTACCGACAGTTTTGGTGCATTGCGTGCAGAAAAGGGCCTCTTTATCAGTGCCGAC
GGTCAGGCCAAAGCCCAGGGGCAGGTGCTGGAGATGCAACCGGCTATTAGCCTGTTGCAAGGTGCTCAGG
AACAGATGGATGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTGCAGCAAAATCTGAGTGAGCTGAAACAAGCCGTGGTATTGCTGAGTGCGCCAAAAGGCATT
GCCTTGAGCAGTGGTGAGCATCTGCAAATGTCCGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATA
CCGACATCAGCGTAGCAAAGAACTTCTTTATTGGTGTGGGAAATACCTTAAGTATCTTCGTCAGAAAACT
GGGGATGAAGTTGATAGCCAATCAGGGTCCAATAACGGTACAGGCGCAAAATGACCTGATGGAGTTATTG
GCGCGCAAAGCGATAACGATCACCAGTACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATAACGC
TAAATGCAGGCGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATCT
GACCAAGGCAGGGTATTACGGGCGACAGGAAAAAGCGAAGCAGGTAGTGGCAATGCCAGAATTTCAGCTG
ATTCCCGGTGGGAAGCATAATCTACAATTTCTATTTACCGATGATGATAATGTACCTTATTCAAATACAC
CGTATATTGCTTATCTTGTCGATGGAAGAGAAATTAAAGGAGTGACAGATGCAAAAGGTAATACGGAAAA
ATTTGTTACCGATGAAGAGCAAAATATAAAAATAAATTTACAGGTATAG

Protein ID: 153950285
SecReT6 ID222
T6SS typei2
Gene symbol-
Locus tagYpsIP31758_0788
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]947132..949834 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA7FEU4
KEGG IDypi:YpsIP31758_0788
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-65, Aligned region: 34..354
DUF2345 [PF10106], Evalue: 5.70E-49, Aligned region: 610..757
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 589..618
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 8.30E-16, Aligned region: 390..481
Protein Sequence: 900 a.a.     [Download]
>gi|153950285|ref|YP_001399772.1| Rhs element Vgr protein [Yersinia pseudotuberculosis IP 31758]
MNTSLPAIRFDHSHHKLVVRDSTAPVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMQDASLTLAA
PVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLAEVGLWFRFTADPKLNIDVVEFYDDQRFYPP
GLTLQAVPPSGMHDSGVESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLIAGSEEREPESESGAFYARLRHERYLNNQARFSGVANAATLGPSQELKVTGNDVPAQFGKGVIIIRI
TSYARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGLFISAD
GQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASPADLQAQISLLQQNLSELKQAVVLLSAPKGI
ALSSGEHLQMSASENLIATAGKNTDISVAKNLFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTENEIKITAKKRITLNAGGSYITLDENRIESGTAGEYITKAGHYERQEKASLKSIIPAFPI
IEPGEHSLRFAFYGDDNVIGSMGHLVGQPYNIRNSAGEVIASGVLDQSGRFPRVKTQEADELTLTLGEEK
WTVEELIASTEDPIGEEFSEPDEYDVDSDPYFENIAQEQQSNRLPDTIINKFIGYVEEDI
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|153946813|ref|NC_009708.1|:947132-949834 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAATACCTCTCTCCCCGCTATTCGGTTTGACCATAGCCATCACAAACTGGTGGTCCGCGACAGCACGG
CTCCCGTCGATGTGCTGGGTTTTGAAGGCCACGAAAGCTTAAGTCAGCCGTTCTGTTACGACATTCAATT
TACCAGCGCAGACAAGGCGATTGACCCGGCCACGATGCTGATGCAGGACGCGTCACTGACATTGGCGGCC
CCGGTGGCCGAAGCCTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCACGGCGTGGTGACCGGAT
TTAAACGCCTGTCTGCTTCAAAAGATGAATGCCGTTACGAACTGAGCCTGCAACCGCGTTTGGCTTTGTT
GTCGCGTAGCCATCAGAACGGGATTTATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCCCGCCGTGAGCAGG
TGATGCAGTACGGCGAAGATGACCTGACCTTTATCAGCCGCCTGCTGGCGGAAGTGGGGCTCTGGTTTCG
TTTTACCGCTGACCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAACGTTTTTACCCGCCA
GGGCTGACGCTACAAGCGGTGCCACCTTCGGGGATGCACGACAGCGGCGTGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGCGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGATCGCAGGCAGCGAAGAGCGTGAGCCGGAAAGTGAAAGTGGGGCGTTTTATGCCCGCCTGC
GCCATGAACGTTACCTGAACAATCAGGCGCGCTTTTCGGGGGTAGCCAATGCGGCGACACTGGGGCCGAG
TCAGGAACTGAAAGTCACCGGAAACGATGTGCCGGCACAGTTTGGTAAAGGGGTGATAATCATCCGCATC
ACCAGCTATGCCCGCCGTGACCGCAGCTATGAAGTGCATTTTGAGGCTATCCCTTACTCCGAAGATTATT
GCTTCCGTCCAGCACTTATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACCTATGGTCATATCGACAAAGACGGGCGTTACCGTGTCAATCTGATGTTCGACCGTGAC
AGTTGGGAGCAGGGTTACGAAAGCCTTTGGGTTCGTCAGGCCCGCCCGTATGCGGGTGACACCTACGGCC
TGCACCTGCCGCTGCTGGCGGGCACCGAAGTGGCGATTGCGTTTGAGGATGGCAACCCGGACCGGCCCTA
TATTGCTTATGTGTTGCACGACTCGGCGCACGGCGACCATGTCACCATCAGTAATTACAAACGCAACGTA
CTTCGCACTCCGTCGAATAACAAACTGCGCCTTGAAGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCACGGGGTGA
AGGTTTTGAGCTGCGTACCGACAGTTTTGGTGCATTGCGTGCAGAAAAGGGCCTCTTTATCAGTGCCGAC
GGTCAGGCCAAAGCCCAGGGGCAGGTGCTGGAGATGCAACCGGCTATTAGCCTGTTGCAAGGTGCTCAGG
AACAGATGGATGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTGCAGCAAAATCTGAGTGAGCTGAAACAAGCCGTGGTATTGCTGAGTGCGCCAAAAGGCATT
GCCTTGAGCAGTGGTGAGCATCTGCAAATGTCCGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATA
CCGACATCAGCGTAGCAAAGAACTTATTTATTGGTGTGGGAAATACCTTAAGTATCTTCGTCAGAAAACT
GGGGATGAAGCTGATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTGATGGAGTTATTG
GCGCGCAAGGCGATAACGATCACCAGTACCGAGAATGAGATAAAAATCACCGCCAAGAAGAGGATTACGC
TGAATGCGGGCGGCAGTTATATCACGCTGGATGAGAATCGGATTGAGTCAGGCACGGCTGGTGAATATAT
AACCAAAGCAGGGCATTACGAGCGGCAGGAAAAGGCGAGTTTAAAATCTATAATACCTGCTTTTCCTATT
ATTGAACCGGGAGAACATAGTTTACGGTTTGCATTCTATGGTGACGATAATGTTATTGGGTCTATGGGAC
ATCTTGTCGGGCAGCCTTACAATATCCGTAATAGCGCTGGTGAAGTTATAGCTTCAGGAGTATTGGATCA
ATCTGGCCGTTTCCCAAGAGTAAAAACTCAAGAAGCGGATGAGTTAACGCTGACTTTAGGTGAGGAAAAA
TGGACAGTAGAAGAGCTTATAGCGTCAACAGAAGATCCTATCGGTGAGGAGTTTAGCGAACCTGATGAAT
ACGATGTAGATAGTGATCCTTATTTCGAAAATATCGCTCAAGAACAACAAAGTAATAGATTGCCTGATAC
AATAATTAATAAATTTATTGGCTATGTAGAAGAGGATATCTAG